Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSQEGDYGRWTISSSDESEEEKPKPDKPSTSSLLCARQGAANEPRYTCSE AQKAAHKRKISPVKFSNTDSVLPPKRQKSGSQEDLGWCLSSSDDELQPEM PQKQAEKVVIKKEKDISAPNDGTAQRTENHGAPACHRLKEEEDEYETSGE GQDIWDMLDKGNPFQFYLTRVSGVKPKYNSGALHIKDILSPLFGTLVSSA QFNYCFDVDWLVKQYPPEFRKKPILLVHGDKREAKAHLHAQAKPYENISL CQAKLDIAFGTHHTKMMLLLYEEGLRVVIHTSNLIHADWHQKTQGIWLSP LYPRIADGTHKSGESPTHFKADLISYLMAYNAPSLKEWIDVIHKHDLSET NVYLIGSTPGRFQGSQKDNWGHFRLKKLLKDHASSMPNAESWPVVGQFSS VGSLGADESKWLCSEFKESMLTLGKESKTPGKSSVPLYLIYPSVENVRTS LEGYPAGGSLPYSIQTAEKQNWLHSYFHKWSAETSGRSNAMPHIKTYMRP SPDFSKIAWFLVTSANLSKAAWGALEKNGTQLMIRSYELGVLFLPSAFGL DSFKVKQKFFAGSQEPMATFPVPYDLPPELYGSKDRPWIWNIPYVKAPDT HGNMWVPS
    • Molecular weight

      93 kDa including tags
    • Amino acids

      1 to 608

Associated products

Specifications

Our Abpromise guarantee covers the use of ab131921 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    Best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AI838772
    • AW493413
    • FLJ11090
    • MGC104252
    • MGC112732
    • RP24-311F12.2
    • SCAN1
    • TDP1
    • TYDP
    • TYDP1_HUMAN
    • Tyr-DNA phosphodiesterase 1
    • Tyrosyl-DNA phosphodiesterase 1
    see all
  • Function

    DNA repair enzyme that can remove a variety of covalent adducts from DNA through hydrolysis of a 3'-phosphodiester bond, giving rise to DNA with a free 3' phosphate. Catalyzes the hydrolysis of dead-end complexes between DNA and the topoisomerase I active site tyrosine residue. Hydrolyzes 3'-phosphoglycolates on protruding 3' ends on DNA double-strand breaks due to DNA damage by radiation and free radicals. Acts on blunt-ended double-strand DNA breaks and on single-stranded DNA. Has low 3'exonuclease activity and can remove a single nucleoside from the 3'end of DNA and RNA molecules with 3'hydroxyl groups. Has no exonuclease activity towards DNA or RNA with a 3'phosphate.
  • Tissue specificity

    Ubiquitously expressed. Similar expression throughout the central nervous system (whole brain, amygdala, caudate nucleus, cerebellum, cerebral cortex, frontal lobe, hippocampus, medulla oblongata, occipital lobe, putamen, substantia nigra, temporal lobe, thalamus, nucleus accumbens and spinal cord) and increased expression in testis and thymus.
  • Involvement in disease

    Spinocerebellar ataxia, autosomal recessive, with axonal neuropathy
  • Sequence similarities

    Belongs to the tyrosyl-DNA phosphodiesterase family.
  • Post-translational
    modifications

    Phosphorylated on serine and/or threonine residues, but not on tyrosine residues.
  • Cellular localization

    Nucleus. Cytoplasm.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab131921 stained with Coomassie Blue.

References

ab131921 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131921.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up