Description

  • Product name

    Recombinant human TDP2 protein
    See all TDP2 proteins and peptides
  • Biological activity

    Specific activity of ab135019 was determined to be 186 pmol/min/µg. Enzyme reaction was performed in a reaction buffer (200 µl) containing 50 mM Tris (pH 7.4), 1 mM MgCl2, 50 mM KCl, 1 mM DTT, 0.1 mg/ml BSA, 2 mM T5PNP and TDP2. Reaction was continuously monitored at 415 nm for 20 min.
  • Purity

    >= 85 % SDS-PAGE.

  • Expression system

    Baculovirus infected Sf9 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MELGSCLEGGREAAEEEGEPEVKKRRLLCVEFASVASCDAAVAQCFLAEN DWEMERALNSYFEPPVEESALERRPETISEPKTYVDLTNEETTDSTTSKI SPSEDTQQENGSMFSLITWNIDGLDLNNLSERARGVCSYLALYSPDVIFL QEVIPPYYSYLKKRSSNYEIITGHEEGYFTAIMLKKSRVKLKSQEIIPFP STKMMRNLLCVHVNVSGNELCLMTSHLESTRGHAAERMNQLKMVLKKMQE APESATVIFAGDTNLRDREVTRCGGLPNNIVDVWEFLGKPKHCQYTWDTQ MNSNLGITAACKLRFDRIFFRAAAEEGHIIPRSLDLLGLEKLDCGRFPSD HWGLLCNLDIIL
    • Predicted molecular weight

      67 kDa including tags
    • Amino acids

      1 to 362
    • Tags

      His tag N-Terminus , GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab135019 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Preservative: 1.36% Imidazole
    Constituents: 0.02% Potassium chloride, 0.05% DTT, 0.63% Tris HCl, 20% Glycerol, 0.64% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • 5'-Tyr-DNA phosphodiesterase
    • 5'-tyrosyl-DNA phosphodiesterase
    • AD 022
    • AD022
    • dJ30M3.3
    • EAP 2
    • EAP II
    • EAP2
    • EAPII
    • ETS 1 associated protein 2
    • ETS 1 associated protein II
    • ETS1 associated protein 2
    • ETS1 associated protein II
    • ETS1-associated protein 2
    • ETS1-associated protein II
    • MGC111021
    • MGC9099
    • RP1-30M3.3
    • tdp2
    • TRAF and TNF receptor associated protein
    • TRAF and TNF receptor-associated protein
    • TTRAP
    • TYDP2_HUMAN
    • Tyr DNA phosphodiesterase 2
    • Tyr-DNA phosphodiesterase 2
    • Tyrosyl DNA phosphodiesterase 2
    • Tyrosyl-DNA phosphodiesterase 2
    see all
  • Function

    DNA repair enzyme that can remove a variety of covalent adducts from DNA through hydrolysis of a 5'-phosphodiester bond, giving rise to DNA with a free 5' phosphate. Catalyzes the hydrolysis of dead-end complexes between DNA and the topoisomerase 2 (TOP2) active site tyrosine residue. Hydrolyzes 5'-phosphoglycolates on protruding 5' ends on DNA double-strand breaks (DSBs) due to DNA damage by radiation and free radicals. The 5'-tyrosyl DNA phosphodiesterase activity can enable the repair of TOP2-induced DSBs without the need for nuclease activity, creating a 'clean' DSB with 5'-phosphate termini that are ready for ligation. Has also 3'-tyrosyl DNA phosphodiesterase activity, but less efficiently and much slower than TDP1. May also act as a negative regulator of ETS1 and may inhibit nuclear factor-kappa-B activation.
  • Tissue specificity

    Widely expressed.
  • Sequence similarities

    Belongs to the CCR4/nocturin family.
  • Cellular localization

    Nucleus. Nucleus > PML body.
  • Information by UniProt

Images

  • Specific activity of ab135019 was determined to be 186 pmol/min/μg.
  • 10% SDS-PAGE analysis of ab135019 (4.6 µg) stained with Coomassie Blue.

References

ab135019 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab135019.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up