Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MGSSHHHHHHSSGLVPRGSHMGSMSDAGGGKKPPVDPQAGPGPGPGRAAG ERGLSGSFPLVLKKLMENPPREARLDKEKGKEKLEEDEAAAASTMAVSAS LMPPIWDKTIPYDGESFHLEYMDLDEFLLENGIPASPTHLAHNLLLPVAE LEGKESASSSTASPPSSSTAIFQPSETVSSTESSLEKERETPSPIDPNCV EVDVNFNPDPADLVLSSVPGGELFNPRKHKFAEEDLKPQPMIKKAKKVFV PDEQKDEKYWTRRKKNNVAAKRSRDARRLKENQITIRAAFLEKENTALRT EVAELRKEVGKCKTIVSKYETKYGPL
    • Molecular weight
      36 kDa including tags
    • Amino acids
      1 to 303
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab167855 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry
    MALDI-TOF
  • Purity
    > 85 % SDS-PAGE.
    ab167855 was purified using conventional chromatography techniques.
  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.32% Tris HCl, 10% Glycerol

General Info

  • Alternative names
    • 2310028D20Rik
    • fb11h02
    • MGC64507
    • Tef
    • TEF_HUMAN
    • tefa
    • tefb
    • tefbeta
    • Thyrotroph embryonic factor
    • VBP
    • Vitellogenin gene binding protein
    • wu:fa12f02
    • wu:fb11h02
    • zTEF[a]
    see all
  • Function
    Transcription factor that binds to and transactivates the TSHB promoter. Binds to a minimal DNA-binding sequence 5'-[TC][AG][AG]TTA[TC][AG]-3'.
  • Sequence similarities
    Belongs to the bZIP family. PAR subfamily.
    Contains 1 bZIP domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab167855 (3µg). Molecular size on SDS-PAGE appears higher.

References

ab167855 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab167855.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up