Recombinant Human TEF1 protein (His tag) (ab226236)

Overview

  • Product name
    Recombinant Human TEF1 protein (His tag)
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Yeast
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MEPSSWSGSESPAENMERMSDSADKPIDNDAEGVWSPDIEQSFQEALAIY PPCGRRKIILSDEGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLARR KSRDFHSKLKDQTAKDKALQHMAAMSSAQIVSATAIHNKLGLPGIPRPTF PGAPGFWPGMIQTGQPGSSQDVKPFVQQAYPIQPAVTAPIPGFEPASAPA PSVPAWQGRSIGTTKLRLVEFSAFLEQQRDPDSYNKHLFVHIGHANHSYS DPLLESVDIRQIYDKFPEKKGGLKELFGKGPQNAFFLVKFWADLNCNIQD DAGAFYGVTSQYESSENMTVTCSTKVCSFGKQVVEKVETEYARFENGRFV YRINRSPMCEYMINFIHKLKHLPEKYMMNSVLENFTILLVVTNRDTQETL LCMACVFEVSNSEHGAQHHIYRLVKD
    • Molecular weight
      50 kDa including tags
    • Amino acids
      1 to 426
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab226236 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry
    LC-MS/MS
  • Purity
    >90% by SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Constituents: 50% Glycerol, Tris buffer

General Info

  • Alternative names
    • AA
    • Atrophia areata peripapillary chorioretinal degeneration
    • NTEF 1
    • NTEF-1
    • NTEF1
    • Protein GT IIC
    • Protein GT-IIC
    • REF 1
    • REF1
    • SV40 transcriptional enhancer factor
    • TCF 13
    • TCF-13
    • TCF13
    • TEA domain family member
    • TEA domain family member 1
    • TEA domain family member 1 (SV40 transcriptional enhancer factor)
    • TEAD 1
    • TEAD 1 protein
    • TEAD-1
    • TEAD1
    • TEAD1 protein
    • TEAD1_HUMAN
    • TEF 1
    • Transcription factor 13
    • Transcription factor 13 (SV40 transcriptional enhancer factor)
    • Transcriptional enhancer factor 1
    • Transcriptional enhancer factor TEF-1
    • Transcriptional enhancer factor TEF1
    see all
  • Function
    Transcription factor which plays a key role in the Hippo signaling pathway, a pathway involved in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein MST1/MST2, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates and inactivates YAP1 oncoprotein and WWTR1/TAZ. Acts by mediating gene expression of YAP1 and WWTR1/TAZ, thereby regulating cell proliferation, migration and epithelial mesenchymal transition (EMT) induction. Binds specifically and cooperatively to the SPH and GT-IIC 'enhansons' (5'-GTGGAATGT-3') and activates transcription in vivo in a cell-specific manner. The activation function appears to be mediated by a limiting cell-specific transcriptional intermediary factor (TIF). Involved in cardiac development. Binds to the M-CAT motif.
  • Tissue specificity
    Preferentially expressed in skeletal muscle. Lower levels in pancreas, placenta, and heart.
  • Involvement in disease
    Defects in TEAD1 are the cause of Sveinsson chorioretinal atrophy (SCRA) [MIM:108985]; also known as atrophia areata (AA) or helicoidal peripapillary chorioretinal degeneration (HPCD). SCRA is characterized by symmetrical lesions radiating from the optic disk involving the retina and the choroid.
  • Sequence similarities
    Contains 1 TEA DNA-binding domain.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of ab226236 could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) TEAD1.

  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of ab226236 could indicate that this peptide derived from Yeast-expressed Homo sapiens (Human) TEAD1.

References

ab226236 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab226236.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up