Description

  • Product name

    Recombinant Human TEKT2 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MATLSVKPSRRFQLPDWHTNSYLLSTNAQLQRDASHQIRQEARVLRNETN NQTIWDEHDNRTRLVERIDTVNRWKEMLDKCLTDLDAEIDALTQMKESAE QNLQAKNLPLDVAIECLTLRESRRDIDVVKDPVEDELHKEVEVIEATKKA LQQKVSQAFEQLCLLQEVQQQLNSDHRGKMETLEIDRGCLSLNLRSPNIS LKVDPTRVPDGSTTLQQWDDFSRFNKDRAEAEMKAATELREATALTIAET NNELEAQRVATEFAFRKRLREMEKVYSELKWQEKNTLEEIAELQEDIRHL EEDLRTKLLSLKLSHTRLEARTYRPNVELCRDQAQYGLTDEVHQLEATIA ALKQKLAQAQDALDALCKHLARLQADIACKANSMLLDTKCMDTRRKLTVP AERFVPEVDTFTRTTNSTLSPLKSCQLELA
    • Amino acids

      1 to 430
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162131 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • TEKT2
    • TEKT2_HUMAN
    • TEKTB1
    • Tektin 2
    • Tektin B1
    • Tektin t
    • Tektin-2
    • Tektin-B1
    • Tektin-t
    • Testicular tektin
    • Testicular tektin B1 like protein
    • Testicular tektin B1-like protein
    see all
  • Function

    Structural component of ciliary and flagellar microtubules. Plays a key role in the assembly or attachment of the inner dynein arm to microtubules in sperm flagella and tracheal cilia. Forms filamentous polymers in the walls of ciliary and flagellar microtubules.
  • Tissue specificity

    Expressed at high levels in testis, trachea and fetal lung, and at lower levels in ovary, pituitary, adult lung, fetal brain and fetal kidney.
  • Sequence similarities

    Belongs to the tektin family.
  • Post-translational
    modifications

    Tyrosine phosphorylated.
  • Cellular localization

    Cell projection > cilium > flagellum. Cytoplasm > cytoskeleton > cilium axoneme. Cytoplasm > cytoskeleton > flagellum axoneme. In sperm, observed in a discontinuous punctate pattern in the flagellum and in the postacrosomal head region.
  • Information by UniProt

Images

  • ab162131 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162131 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162131.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up