Overview

  • Product name

    Recombinant Human TEM1 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      QDPWAAEPRAACGPSSCYALFPRRRTFLEAWRACRELGGDLATPRTPE EAQRVDSLVGAGPASRLLWIGLQRQARQCQLQRPLRGFTWTTGDQDTAFT NWAQPASGGPCPAQRCVALEASGEHRWLEGSCTLAVDGYLCQFGFEGACP ALQDEAGQAGPAVYTTPFHLVSTEFEWLPFGSVAAVQCQAGRGASLLCVK QPEGGVGWSRAGPLCLGTGCSPDNGGCEHECVEEVDGHVSCRCTEGFRLA ADGRSCEDPCAQAPCEQQCEPGGPQGYSCHCRLGFRPAEDDPHRCVDTDE CQIAGVCQQMCVNYVGGFECYCSEGHELEADGISCSPAGAMGAQASQDLG DELLDDGEDEEDEDEAWKAFNGGWTEMPGILWMEPTQPPDFALAYRPSFP EDREPQIPYPEPTWPPPLSAPRVPYHSSVLSVTRPVVVSATHPTLPSAHQ PPVIPATHPALSRDHQIPVIAANYPDLPSAYQPGILSVSHSAQPPAHQPP MISTKYPELFPAHQSPMFPDTRVAGTQTTTHLPGIPPNHAPLVTTLGAQL PPQAPDALVLRTQATQLPIIPTAQPSLTTTSRSPVSPAHQISVPAATQPA ALPTLLPSQSPTNQTSPISPTHPHSKAPQIPREDGPSPKLALWLPSPAPT AAPTALGEAGLAEHSQRDDRWLLVALLVPTCVFLVVLLALGIVYCTRCGP HAPNKRITDCYRWVIHAGSKSPTEPMPPRGSLTGVQTCRTSV
    • Molecular weight

      107 kDa including tags
    • Amino acids

      18 to 757

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132505 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CD164 sialomucin like 1
    • CD164L1
    • CD248
    • CD248 antigen endosialin
    • CD248 molecule endosialin
    • CD248_HUMAN
    • Endosialin
    • TEM 1
    • TEM1
    • Tumor endothelial marker 1
    see all
  • Function

    May play a role in tumor angiogenesis.
  • Tissue specificity

    Expressed in tumor endothelial cells but absent or barely detectable in normal endothelial cells. Expressed in metastatic lesions of the liver and during angiogenesis of corpus luteum formation and wound healing. Expressed in vascular endothelial cells of malignant tumors but not in normal blood vessels. Expressed in stromal fibroblasts.
  • Sequence similarities

    Contains 1 C-type lectin domain.
    Contains 1 EGF-like domain.
    Contains 1 Sushi (CCP/SCR) domain.
  • Post-translational
    modifications

    O-glycosylated with sialylated oligosaccharides.
    May be N-glycosylated.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132505 stained with Coomassie Blue.

References

ab132505 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132505.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up