Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MLLRLLLAWAAAGPTLGQDPWAAEPRAACGPSSCYALFPRRRTFLEAWRA CRELGGDLATPRTPEEAQRVDSLVGAGPASRLLWIGLQRQARQCQLQRPL RGFTWTTGDQDTAFTNWAQPASGGPCPAQRCVALEASGEHRWLEGSCTLA VDGYLCQFGFEGACPALQDEAGQAGPAVYTTPFHLVSTEFEWLPFGSVAA VQCQAGRGASLLCVKQPEGGVGWSRAGPLCLGTGCSPDNGGCEHECVEEV DGHVSCRCTEGFRLAADGRSCEDPCAQAPCEQQCEPGGPQGYSCHCRLGF RPAEDDPHRCVDTDECQIAGVCQQMCVNYVGGFECYCSEGHELEADGISC SPAGAMGAQASQDLGDELLDDGEDEEDEDEAWKAFNGGWTEMPGILWMEP TQPPDFALAYRPSFPEDREPQIPYPEPTWPPPLSAPRVPYHSSVLSVTRP VVVSATRPTLPSAHQPPVIPATHPALSRDHQIPVIAANYPDLPSAYQPGI LSVSHSAQPPAHQPPMISTKYPELFPAHQSPMFPDTRVAGTQTTTHLPGI PPNHAPLVTTLGAQLPPQAPDALVLRTQATQLPIIPTAQPSLTTTSRSPV SPAHQISVPAATQPAALPTLLPSQSPTNQTSPISPTHPHSKAPQIPREDG PSPKLALWLPSPAPTAAPTALGEAGLAEHSQRDDRWLLVALLVPTCVFLV VLLALGIVYCTRCGPHAPNKRITDCYRWVIHAGSKSPTEPMPPRGSLTGV QTCRTSV
    • Amino acids

      1 to 757
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab153440 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • CD164 sialomucin like 1
    • CD164L1
    • CD248
    • CD248 antigen endosialin
    • CD248 molecule endosialin
    • CD248_HUMAN
    • Endosialin
    • TEM 1
    • TEM1
    • Tumor endothelial marker 1
    see all
  • Function

    May play a role in tumor angiogenesis.
  • Tissue specificity

    Expressed in tumor endothelial cells but absent or barely detectable in normal endothelial cells. Expressed in metastatic lesions of the liver and during angiogenesis of corpus luteum formation and wound healing. Expressed in vascular endothelial cells of malignant tumors but not in normal blood vessels. Expressed in stromal fibroblasts.
  • Sequence similarities

    Contains 1 C-type lectin domain.
    Contains 1 EGF-like domain.
    Contains 1 Sushi (CCP/SCR) domain.
  • Post-translational
    modifications

    O-glycosylated with sialylated oligosaccharides.
    May be N-glycosylated.
  • Cellular localization

    Membrane.
  • Information by UniProt

Images

  • ab153440 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab153440 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab153440.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up