Overview

Description

  • Nature

    Recombinant
  • Source

    HEK 293 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      LSPQPGAGHDEGPGSGWAAKGTVRGWNRRARESPGHVSEPDRTQLSQDLG GGTLAMDTLPDNRTRVVEDNHSYYVSRLYGPSEPHSRELWVDVAEANRSQ VKIHTILSNTHRQASRVVLSFDFPFYGHPLRQITMATGGFIFMGDVIHRM LTATQYVAPLMANFNPGYSDNSTVVYFDNGTVFVVQWDHVYLQGWEDKGS FTFQAALHHDGRIVFAYKEIPMSVPEISSSQHPVKTGLSDAFMILNPSPD VPESRRRSIFEYHRIELDPSKVTSMSAVEFTPLPTCLQHRSCDACMSSDL TFNCSWCHVLQRCSSGFDRYRQEWMDYGCAQEAEGRMCEDFQDEDHDSAS PDTSFSPYDGDLTTTSSSLFIDSLTTEDDTKLNPYAGGDGLQNNLSPKTK GTPVHLGTVDHHHHHH
    • Molecular weight

      47 kDa including tags
    • Amino acids

      19 to 426
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152011 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Endotoxin level

    < 1.000 Eu/µg
  • Purity

    > 95 % SDS-PAGE.
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 7.20
    Constituents: 94% Phosphate Buffer, 5% Trehalose, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names

    • DKFZp686F0937
    • FLJ36270
    • FLJ45632
    • OTTHUMP00000164240
    • Plexin domain containing 1
    • Plexin domain containing protein 1 precursor
    • Plexin domain-containing protein 1
    • Plxdc1
    • PXDC1_HUMAN
    • TEM3
    • TEM7
    • Tumor endothelial marker 3
    • Tumor endothelial marker 7
    see all
  • Function

    Plays a critical role in endothelial cell capillary morphogenesis.
  • Tissue specificity

    Detected in endothelial cells from colorectal cancer, and in endothelial cells from primary cancers of the lung, liver, pancreas, breast and brain. Not detectable in endothelial cells from normal tissue. Expressed in fibrovascular membrane with increased expression in individuals with proliferative diabetic retinopathy.
  • Sequence similarities

    Belongs to the plexin family.
  • Post-translational
    modifications

    N-glycosylated.
  • Cellular localization

    Cytoplasm; Secreted and Cell membrane. Cell junction > tight junction. Localized predominantly at the tight junctions of vascular endothelial cells and to a lesser extent at the luminal surface of vascular endothelial cells.
  • Information by UniProt

References

ab152011 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152011.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up