Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MATAERRALGIGFQWLSLATLVLICAGQGGRREDGGPACYGGFDLYFILD KSGSVLHHWNEIYYFVEQLAHKFISPQLRMSFIVFSTRGTTLMKLTEDRE QIRQGLEELQKVLPGGDTYMHEGFERASEQIYYENRQGYRTASVIIALTD GELHEDLFFYSEREANRSRDLGAIVYCVGVKDFNETQLARIADSKDHVFP VNDGFQALQGIIHSILKKSCIEILAAEPSTICAGESFQVVVRGNGFRHAR NVDRVLCSFKINDSVTLNEKPFSVEDTYLLCPAPILKEVGMKAALQVSMN DGLSFISSSVIITTTHCSDGSILAIALLILFLLLALALLWWFWPLCCTVI IKEVPPPPAEESEENKIK
    • Molecular weight

      68 kDa including tags
    • Amino acids

      1 to 368
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab132123 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
    This protein is best used within three months from the date of receipt.

     This product was previously labelled as TEM8

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Anthrax toxin receptor 1
    • ANTR1_HUMAN
    • Antxr1
    • ATR
    • Tumor endothelial marker 8
    see all
  • Function

    Plays a role in cell attachment and migration. Interacts with extracellular matrix proteins and with the actin cytoskeleton. Mediates adhesion of cells to type 1 collagen and gelatin, reorganization of the actin cytoskeleton and promotes cell spreading. Plays a role in the angiogenic response of cultured umbilical vein endothelial cells.
  • Tissue specificity

    Detected in umbilical vein endothelial cells (at protein level). Highly expressed in tumor endothelial cells.
  • Involvement in disease

    Defects in ANTXR1 are associated with susceptibility to hemangioma capillary infantile (HCI) [MIM:602089]. HCI are benign, highly proliferative lesions involving aberrant localized growth of capillary endothelium. They are the most common tumor of infancy, occurring in up to 10% of all births. Hemangiomas tend to appear shortly after birth and show rapid neonatal growth for up to 12 months characterized by endothelial hypercellularity and increased numbers of mast cells. This phase is followed by slow involution at a rate of about 10% per year and replacement by fibrofatty stroma.
  • Sequence similarities

    Belongs to the ATR family.
    Contains 1 VWFA domain.
  • Domain

    Binding to PA occurs through the VWA domain.
  • Cellular localization

    Cell membrane. Cell projection > lamellipodium membrane. Cell projection > filopodium membrane. At the membrane of lamellipodia and at the tip of actin-enriched filopodia. Colocalizes with actin at the base of lamellipodia.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab132123, stained with Coomassie Blue

References

ab132123 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132123.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up