Overview

  • Product name

    Recombinant Human Ten-1 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      TRRFADIQLQHGALCFNIRYGTTVEEEKNHVLEIARQRAVAQAWTKEQRR LQEGEEGIRAWTEGEKQQLLSTGRVQGYDGYFVLSVEQYLELSDSANNIH FMRQSEIGRR
    • Amino acids

      2616 to 2725
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160860 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

     This product was previously labelled as ODZ1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Odz (odd Oz/ten m Drosophila) homolog 1
    • Odz (odd Oz/ten m Drosophila) homolog 3
    • ODZ 1
    • ODZ 3
    • Odz odd Oz/ten m homolog 1
    • ODZ3
    • OTTHUMP00000062724
    • Protein Odd Oz/ten m homolog 1
    • Ten 1
    • TEN M1
    • Ten1
    • Tenascin M
    • TenascinM
    • Teneurin 1
    • Teneurin1
    • TNM
    • TNM 1
    • TNM1
    see all
  • Relevance

    ODZ1 (odz, odd Oz/ten-m homolog 1) is expressed in fetal brain and may have a role in cellular signal transduction.
  • Cellular localization

    Membrane; Single-pass type II membrane protein.

Images

  • ab160860 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160860 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab160860.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up