Recombinant Human Tensin 1 protein (ab159732)

Overview

  • Product name
    Recombinant Human Tensin 1 protein
  • Protein length
    Full length protein

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MSVSRTMEDSCELDLVYVTERIIAVSFPSTANEENFRSNLREVAQMLKSK HGGNYLLFNLSERRPDITKLHAKVLEFGWPDLHTPALEKICSICKAMDTW LNADPHNVVVLHNKGNRGRIGVVIAAYMHYSNISASADQALDRFAMKRFY EDKIVPIGQPSQRRYVHYFSGLLSGSIKMNNKPLFLHHVIMHGIPNFESK GGCRPFLRIYQAMQPVYTSGIYNIPGDSQTSVCITIEPGLLLKGDILLKC YHKKFRSPARDVIFRVQFHTCAIHDLGVVFGKEDLDDAFKDDRFPEYGKV EFVFSYGPEKIQGMEHLENGPSVSVDYNTSDPLIRWDSYDNFSGHRDDGM EDGNKQNTNSQSIGSISGGLEDQYTWPDTHWPSQS
    • Amino acids
      1 to 385
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159732 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • matrix-remodelling associated 6
    • Matrix-remodelling-associated protein 6
    • MGC88584
    • MST091
    • MST122
    • MST127
    • MSTP091
    • MSTP122
    • MSTP127
    • MXRA6
    • TENS1_HUMAN
    • Tensin
    • Tensin-1
    • TNS
    • TNS1
    see all
  • Function
    Involved in fibrillar adhesion formation. May be involved in cell migration, cartilage development and in linking signal transduction pathways to the cytoskeleton.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Contains 1 C2 tensin-type domain.
    Contains 1 phosphatase tensin-type domain.
    Contains 1 SH2 domain.
  • Post-translational
    modifications
    Rapidly cleaved by calpain II.
  • Cellular localization
    Cell surface. Cell junction, focal adhesion. Cytoplasm, cytoskeleton. Localized at cell periphery preferentially to fibrillar adhesions than focal adhesions. Translocates from the cell edge to cell center in an ITGB1BP1-dependent manner.
  • Information by UniProt

Images

  • ab159732 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159732 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159732.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up