Overview

  • Product name
    Recombinant Human TEP1 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      ASMDSDASMDSEPTPHLKTRQRRKIHSGSVTALHVLPELLVTASKDRDVK LWERPSMQLLGLFRCEGSVSCLEPWLGANSTLQLAVGDVQGNVYFLNWE
    • Amino acids
      2529 to 2627
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159670 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • p240
    • p80 telomerase homolog
    • Telomerase associated protein 1
    • Telomerase protein component 1
    • TLP1
    • TP1
    • TROVE domain family, member 1
    • TROVE1
    • VAULT2
    see all
  • Relevance
    Telomerase is an RNA-dependent DNA polymerase that uses an RNA component to add telomeric repeat sequences at the ends of chromosomes. Besides the RNA component which serves as the template that specifies the telomeric repeat, the telomerase complex contains a reverse transcriptase protein (TRT) and various accessory proteins including the telomerase-associated protein 1 (TEP1). Telomerase activity is low in most somatic cells, causing the gradual shortening of telomeres which can ultimately lead to telomere fusion and cell death. High levels of telomerase activity are widely seen in cancerous cells and while recent experiments have suggested that telomerase may be a viable target in cancer therapy, expression levels of TEP1 do not correlate with malignancy. At least two isoforms of TP1 are known to exist.
  • Cellular localization
    Nuclear (probable). Telomere.

Images

  • ab159670 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159670 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159670.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up