Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MDRSKRNSIAGFPPRVERLEEFEGGGGGEGNVSQVGRVWPSSYRALISAF SRLTRLDDFTCEKIGSGFFSEVFKVRHRASGQVMALKMNTLSSNRANMLK EVQLMNRLSHPNILRFMGVCVHQGQLHALTEYINSGNLEQLLDSNLHLPW TVRVKLAYDIAVGLSYLHFKGIFHRDLTSKNCLIKRDENGYSAVVADFGL AEKIPDVSMGSEKLAVVGSPFWMAPEVLRDEPYNEKADVFSYGIILCEII ARIQADPDYLPRTENFGLDYDAFQHMVGDCPPDFLQLTFNCCNMDPKLRP SFVEIGKTLEEILSRLQEEEQERDRKLQPTARGLLEKAPGVKRLSSLDDK IPHKSPCPRRTIWLSRSQSDIFSRKPPRTVSVLDPYYRPRDGAARTPKVN PFSARQDLMGGKIKFFDLPSKSVISLVFDLDAPGPGTMPLADWQEPLAPP IRRWRSLPGSPEFLHQEACPFVGREESLSDGPPPRLSSLKYRVKEIPPFR ASALPAAQAHEAMDCSILQEENGFGSRPQGTSPCPAGASEEMEVEERPAG STPATFSTSGIGLQTQGKQDG
    • Molecular weight

      92 kDa including tags
    • Amino acids

      1 to 571

Associated products

Specifications

Our Abpromise guarantee covers the use of ab140418 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Biological activity

    The specific activity of ab140418 was determined to be 3.5 nmol/min/mg.
  • Applications

    Western blot

    Functional Studies

    SDS-PAGE

  • Purity

    > 80 % Densitometry.

  • Form

    Liquid
  • Additional notes

    ab85154 (Human Cofilin full length protein) can be utilized as a substrate for assessing Kinase activity

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.31% Glutathione, 0.002% PMSF, 0.004% DTT, 0.79% Tris HCl, 0.003% EDTA, 25% Glycerol, 0.88% Sodium chloride

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

General Info

  • Alternative names

    • Dual specificity testis specific protein kinase 2
    • Dual specificity testis-specific protein kinase 2
    • MGC29168
    • OTTHUMP00000009093
    • RP23-109A3.2
    • Tesk2
    • TESK2_HUMAN
    • Testicular protein kinase 2
    • Testis specific kinase 2
    see all
  • Function

    Dual specificity protein kinase activity catalyzing autophosphorylation and phosphorylation of exogenous substrates on both serine/threonine and tyrosine residues. Phosphorylates cofilin at 'Ser-3'. May play an important role in spermatogenesis.
  • Tissue specificity

    Predominantly expressed in testis and prostate. Found predominantly in non-germinal Sertoli cells.
  • Sequence similarities

    Belongs to the protein kinase superfamily. TKL Ser/Thr protein kinase family.
    Contains 1 protein kinase domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • Kinase Activity Plot. The specific activity of ab140418 was determined to be 3.5 nmol/min/mg.
  • SDS-PAGE analysis of ab140418.

References

ab140418 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab140418.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up