Overview

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      RFRIDPSSPLHEKNLEDNLQSLATRLAPIYKQYAPVAYQNQVEYENVARE CRLGSKEGRPFSGVTACLDFCAHPHRDIHNMNNGSTVVCTLTREDNRSLG VIPQDEQLHVLPLYKLSDTDEFGSKEGMEAKIKSGAIEVLAPRRKKRTCF TQPVPRSGKKRAAMMTEVLAHKIRAVEKKPIPRIKRKNNSTTTNNSKPSS LPTLGSNTETVQPEVKSETEPHFILKSSDNTKTYSLMPSAPHPVKEASPG FSWSPKTASATPAPLKNDATASCGFSERSSTPHCTMPSGRLSGANAAAAD GPGISQLGEVAPLPTLSAPVMEPLINSEPSTGVTEPLTPHQPNHQPSFLT SPQDLASSPMEEDEQHSEADEPPSDEPLSDDPLSPAEEKLPHIDEYWSDS EHIFLDANIGGVAIAPAHGSVLIECARRELHATTPVEHPNRNHPTRLSLV FYQHKNLNKPQHGFELNKIKFEAKEAKNKKMKASEQKDQAANEGPEQSSE VNELNQIPSHKALTLTHDNVVTVSPYALTHVAGPYNHWV
    • Molecular weight

      110 kDa including tags
    • Amino acids

      1598 to 2136

Specifications

Our Abpromise guarantee covers the use of ab140810 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

  • Purity

    > 90 % Densitometry.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 7.50
    Constituents: 0.31% Glutathione, 0.002% PMSF, 0.004% DTT, 0.79% Tris HCl, 0.003% EDTA, 0.29% Sodium chloride

General Info

  • Alternative names

    • bA119F7.1
    • CXXC 6
    • CXXC finger 6
    • CXXC type zinc finger protein 6
    • CXXC zinc finger 6
    • CXXC-type zinc finger protein 6
    • CXXC6
    • KIAA1676
    • LCX
    • Leukemia associated protein with a CXXC domain
    • Leukemia-associated protein with a CXXC domain
    • Methylcytosine dioxygenase TET1
    • Ten eleven translocation 1
    • Ten eleven translocation 1 gene protein
    • Ten eleven translocation 1 gene protein homolog
    • Ten-eleven translocation 1 gene protein
    • Tet 1
    • Tet methylcytosine dioxygenase 1
    • Tet oncogene 1
    • TET1
    • TET1_HUMAN
    see all
  • Function

    Dioxygenase that catalyzes the conversion of methylcytosine (5mC) to 5-hydroxymethylcytosine (hmC). Plays a role in embryonic stem (ES) cell maintenance and inner cell mass (ICM) cell specification, possibly by participating in DNA demethylation. Specifically binds 5mC, a minor base in mammalian DNA found in repetitive DNA elements that is crucial for retrotransposon silencing and mammalian development. 5mC is present in ES cells and is enriched in the brain, especially in Purkinje neurons. The clear function of hmC is still unclear but it could constitute an intermediate component in cytosine demethylation. A role of hmC in DNA demethylation is supported by TET1 function in ES cell maintenance, which is required to prevent NANOG hypermethylation and maintain NANOG expression in ES cells.
  • Tissue specificity

    Expressed in fetal heart, lung and brain, and in adult skeletal muscle, thymus and ovary. Not detected in adult heart, lung or brain.
  • Involvement in disease

    Note=A chromosomal aberration involving TET1 may be a cause of acute leukemias. Translocation t(10;11)(q22;q23) with MLL. This is a rare chromosomal translocation 5' MLL-TET1 3'.
  • Sequence similarities

    Belongs to the TET family.
    Contains 1 CXXC-type zinc finger.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • SDS PAGE analysis of ab140810 at ~110 kDa.

References

ab140810 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab140810.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up