Overview

  • Product name

    Recombinant Human TET3 protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Baculovirus infected Sf9 cells
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MEERYGEKGKAIRIEKVIYTGKEGKSSRGCPIAKWVIRRHTLEEKLLCLV RHRAGHHCQNAVIVILILAWEGIPRSLGDTLYQELTDTLRKYGNPTSRRC GLNDDRTCACQGKDPNTCGASFSFGCSWSMYFNGCKYARSKTPRKFRLAG DNPKEEEVLRKSFQDLATEVAPLYKRLAPQAYQNQVTNEEIAIDCRLGLK EGRPFAGVTACMDFCAHAHKDQHNLYNGCTVVCTLTKEDNRCVGKIPEDE QLHVLPLYKMANTDEFGSEENQNAKVGSGAIQVLTAFPREVRRLPEPAKS CRQRQLEARKAAAEKKKIQKEKLSTPEKIKQEALELAGITSDPGLSLKGG LSQQGLKPSLKVEPQNHFSSFKYSGNAVVESYSVLGNCRPSDPYSMNSVY SYHSYYAQPSLTSVNGFHSKYALPSFSYYGFPSSNPVFPSQFLGPGAWGH SGSSGSFEKKPDLHALHNSLSPAYGGAEFAELPSQAVPTDAHHPTPHHQQ PAYPGPKEYLLPKAPLLHSVSRDPSPFAQSSNCYNRSIKQEPVDPLTQAE PVPRDAGKMGKTPLSEVSQNGGPSHLWGQYSGGPSMSPKRTNGVGGSWGV FSSGESPAIVPDKLSSFGASCLAPSHFTDGQWGLFPGEGQQAASHSGGRL RGKPWSPCKFGNSTSALAGPSLTEKPWALGAGDFNSALKGSPGFQDKLWN PMKGEEGRIPAAGASQLDRAWQSFGLPLGSSEKLFGALKSEEKLWDPFSL EEGPAEEPPSKGAVKEEKGGGGAEEEEEELWSDSEHNFLDENIGGVAVAP AHGSILIECARRELHATTPLKKPNRCHPTRISLVFYQHKNLNQPNHGLAL WEAKMKQLAERARARQEEAARLGLGQQEAKLYGKKRKWGGTVVAEPQQKE KKGVVPTRQALAVPTDSAVTVSSYAYTKVTGPYSRWI
    • Molecular weight

      102 kDa
    • Amino acids

      724 to 1660
    • Tags

      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab172188 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

  • Purity

    > 70 % Densitometry.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.5
    Constituents: 0.79% Tris HCl, 0.29% Sodium chloride, 0.31% Glutathione, 0.003% EDTA, 0.004% DTT, 25% Glycerol, 0.002% PMSF

General Info

  • Alternative names

    • hCG_40738
    • KIAA0401
    • Methylcytosine dioxygenase TET3
    • Probable methylcytosine dioxygenase TET3
    • Tet methylcytosine dioxygenase 3
    • Tet oncogene family member 3
    • Tet3
    • TET3_HUMAN
    see all
  • Function

    Catalyzes the conversion of methylcytosine (5mC) to 5-hydroxymethylcytosine (hmC).
  • Tissue specificity

    Expressed in colon, muscle, adrenal gland and peripheral blood lymphocytes.
  • Sequence similarities

    Belongs to the TET family.
  • Developmental stage

    Expressed in fetal brain but not adult brain.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab172188.

References

ab172188 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab172188.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up