Bioactive grade

Recombinant human Tetranectin protein (ab191970)

Description

  • Product name

    Recombinant human Tetranectin protein
    See all Tetranectin proteins and peptides
  • Biological activity

    Measured by its binding ability in a functional ELISA.

    Immobilized recombinant human HGF at 5 µg/ml (100 μL/well), the concentration of ab191970 that produces 50% of the optimal binding response is found to be approximately 1 - 10 µg/ml.

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      EPPTQKPKKIVNAKKDVVNTKMFEELKSRLDTLAQEVALLKEQQALQTVC LKGTKVHMKCFLAFTQTKTFHEASEDCISRGGTLGTPQTGSENDALYEYL RQSVGNEAEIWLGLNDMAAEGTWVDMTGARIAYKNWETEITAQPDGGKTE NCAVLSGAANGKWFDKRCRDQLPYICQFGIV
    • Predicted molecular weight

      21 kDa including tags
    • Amino acids

      22 to 202
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is for the mature full length protein from aa 22 to 202. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab191970 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituent: 100% PBS

    5-10% trehalose is commonly used for freeze drying, and after reconstitution, the trehalose is mostly about 3-5%.
    Lyophilized from 0.22 µm filtered solution.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Size: 100 µg It is recommended to reconstitute the lyophilized product in 100 µl sterile deionized water to a final concentration of 1 mg/ml. Solubilize for 30 to 60 minutes at room temperature with occasional gentle mixing. Carrier protein (0.1% HSA or BSA) is strongly recommended for further dilution and long term storage.

General Info

  • Alternative names

    • C type lectin domain family 3 member B
    • C-type lectin domain family 3 member B
    • Clec3b
    • Plasminogen kringle 4 binding protein
    • Plasminogen kringle 4-binding protein
    • TETN_HUMAN
    • Tetranectin
    • Tetranectin (plasminogen binding protein)
    • TN
    • TNA
    see all
  • Function

    Tetranectin binds to plasminogen and to isolated kringle 4. May be involved in the packaging of molecules destined for exocytosis.
  • Tissue specificity

    Found in plasma.
  • Sequence similarities

    Contains 1 C-type lectin domain.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • Human CLEC3B (His Tag) on SDS-PAGE under reducing (R) condition. The gel was stained overnight with Coomassie Blue. The purity of the protein is greater than 95%.
  • The purity of ab191970 was determined by DTT-reduced (+) SDS-PAGE and staining overnight with Coomassie Blue. DTT-reduced Protein migrates as 22 kDa in SDS-PAGE due to glycosylation.

References

ab191970 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab191970.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up