Overview

  • Product name

    Recombinant Human TFAP2D protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MSTTFPGLVHDAEIRHDGSNSYRLMQLGCLESVANSTVAYSSSSPLTYST TGTEFASPYFSTNHQYTPLHHQSFHYEFQHSHPAVTPDAYSLNSLHHSQQ YYQQIHHGEPTDFINLHNARALKSSCLDEQRRELGCLDAYRRHDLSLMSH GSQYGMHPDQRLLPGPSLGLAAAGADDLQGSVEAQCGLVLNGQGGVIRRG GTCVVNPTDLFCSVPGRLSLLSSTSKYKVTIAEVKRRLSPPECLNASLLG GILRRAKSKNGGRCLREKLDRLGLNLPAGRRKAANVTLLTSLVEGEALHL ARDFGYTCETEFPAKAVGEHLARQHMEQKEQTARKKMILATKQICKEFQD LLSQDRSPLGSSRPTPILDLDIQRHLTHFSLITHGFGTPAICAALSTFQT VLSEMLNYLEKHTTHKNGGAADSGQGHANSEKAPLRKTSEAAVKEGKTEK TD
    • Amino acids

      1 to 452
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab164436 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • activating enhancer binding protein 2 beta like 1
    • activating enhancer binding protein 2 delta
    • Activating enhancer-binding protein 2-delta
    • AP 2 like
    • AP2 delta
    • AP2 like
    • AP2-delta
    • AP2D_HUMAN
    • TFAP2BL1
    • tfap2d
    • transcription factor AP 2 beta like 1
    • transcription factor AP 2 delta
    • transcription factor AP 2 delta (activating enhancer binding protein 2 delta)
    • transcription factor AP-2 delta (activating enhancer binding protein 2 delta)
    • Transcription factor AP-2-beta-like 1
    • Transcription factor AP-2-delta
    • transcription factor AP2 beta like 1
    • transcription factor AP2 delta
    • transcription factor AP2 delta (activating enhancer binding protein 2 delta)
    see all
  • Function

    Sequence-specific DNA-binding protein that interacts with inducible viral and cellular enhancer elements to regulate transcription of selected genes. AP-2 factors bind to the consensus sequence 5'-GCCNNNGGC-3' and activate genes involved in a large spectrum of important biological functions including proper eye, face, body wall, limb and neural tube development. They also suppress a number of genes including MCAM/MUC18, C/EBP alpha and MYC.
  • Tissue specificity

    Highly expressed in brain, placenta, skeletal muscle, thymus, small intestine, and prostate, and expressed at lower levels in leukocyte, spleen, testis, ovary and colon. Barely detectable in heart, kidney, liver, lung or pancreas.
  • Sequence similarities

    Belongs to the AP-2 family.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab164436 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab164436 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab164436.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up