Recombinant Human TFE3 protein (ab152741)
- Datasheet
- References
- Protocols
Description
-
Product name
Recombinant Human TFE3 protein -
Expression system
Wheat germ -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
RPPPAQVPREVLKVQTHLENPTRYHLQQARRQQVKQYLSTTLGPKLASQA LTPPPGPASAQPLPAPEAAHTTGPTGSAPNSPMALLTIG -
Predicted molecular weight
36 kDa including tags -
Amino acids
166 to 254
-
Specifications
Our Abpromise guarantee covers the use of ab152741 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
Western blot
SDS-PAGE
ELISA
-
Form
Liquid -
Additional notes
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.
pH: 8.00
Constituents: 0.31% Glutathione, 0.79% Tris HCl
General Info
-
Alternative names
- bHLH e33
- bHLHe33
- Class E basic helix-loop-helix protein 33
see all -
Function
Transcription factor that specifically recognizes and binds E-box sequences (3'-CANNTG-5'). Efficient DNA-binding requires dimerization with itself or with another MiT/TFE family member such as TFEB or MITF. In association with TFEB, activates the expression of CD40L in T-cells, thereby playing a role in T-cell-dependent antibody responses in activated CD4(+) T-cells and thymus-dependent humoral immunity. Specifically recognizes the MUE3 box, a subset of E-boxes, present in the immunoglobulin enhancer. It also binds very well to a USF/MLTF site. -
Tissue specificity
Ubiquitous in fetal and adult tissues. -
Involvement in disease
Note=A chromosomal aberration involving TFE3 is found in patients with alveolar soft part sarcoma. Translocation t(X;17)(p11;q25) with ASPSCR1 forms a ASPSCR1-TFE3 fusion protein.
Note=Chromosomal aberrations involving TFE3 are found in patients with papillary renal cell carcinoma. Translocation t(X;1)(p11.2;q21.2) with PRCC; translocation t(X;1)(p11.2;p34) with PSF; inversion inv(X)(p11.2;q12) that fuses NONO to TFE3. -
Sequence similarities
Belongs to the MiT/TFE family.
Contains 1 basic helix-loop-helix (bHLH) domain. -
Post-translational
modificationsSumoylated; does not affect dimerization with MITF. -
Cellular localization
Nucleus. - Information by UniProt
Images
-
SDS-PAGE - Recombinant Human TFE3 protein (ab152741)12.5% SDS-PAGE analysis of ab152741 stained with Coomassie Blue.
Datasheets and documents
References
ab152741 has not yet been referenced specifically in any publications.
