Overview

  • Product name
    Recombinant Human TFE3 protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RPPPAQVPREVLKVQTHLENPTRYHLQQARRQQVKQYLSTTLGPKLASQA LTPPPGPASAQPLPAPEAAHTTGPTGSAPNSPMALLTIG
    • Molecular weight
      36 kDa including tags
    • Amino acids
      166 to 254

Specifications

Our Abpromise guarantee covers the use of ab152741 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • bHLH e33
    • bHLHe33
    • Class E basic helix-loop-helix protein 33
    • RCCP 2
    • RCCP2
    • RCCX1
    • Renal cell carcinoma, papillary
    • Tcfe 3
    • Tcfe3
    • TFE 3
    • Tfe3
    • TFE3_HUMAN
    • TFEA
    • Transcription factor binding to IGHM enhancer 3
    • Transcription factor E family, member A
    • Transcription factor E3
    • Transcription factor for IgH enhancer
    • Transcription factor for immunoglobulin heavy chain enhancer 3
    see all
  • Function
    Transcription factor that specifically recognizes and binds E-box sequences (3'-CANNTG-5'). Efficient DNA-binding requires dimerization with itself or with another MiT/TFE family member such as TFEB or MITF. In association with TFEB, activates the expression of CD40L in T-cells, thereby playing a role in T-cell-dependent antibody responses in activated CD4(+) T-cells and thymus-dependent humoral immunity. Specifically recognizes the MUE3 box, a subset of E-boxes, present in the immunoglobulin enhancer. It also binds very well to a USF/MLTF site.
  • Tissue specificity
    Ubiquitous in fetal and adult tissues.
  • Involvement in disease
    Note=A chromosomal aberration involving TFE3 is found in patients with alveolar soft part sarcoma. Translocation t(X;17)(p11;q25) with ASPSCR1 forms a ASPSCR1-TFE3 fusion protein.
    Note=Chromosomal aberrations involving TFE3 are found in patients with papillary renal cell carcinoma. Translocation t(X;1)(p11.2;q21.2) with PRCC; translocation t(X;1)(p11.2;p34) with PSF; inversion inv(X)(p11.2;q12) that fuses NONO to TFE3.
  • Sequence similarities
    Belongs to the MiT/TFE family.
    Contains 1 basic helix-loop-helix (bHLH) domain.
  • Post-translational
    modifications
    Sumoylated; does not affect dimerization with MITF.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152741 stained with Coomassie Blue.

References

ab152741 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152741.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up