Description

  • Product name

    Recombinant Human TFF2 protein
    See all TFF2 proteins and peptides
  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MKHHHHHHASEKPSPCQCSRLSPHNRTNCGFPGITSDQCFDNGCCFDSSV TGVPWCFHPLPKQESDQCVMEVSDRRNCGYPGISPEECASRKCCFSNFIF EVPWCFFPKSVEDCHY
    • Predicted molecular weight

      13 kDa including tags
    • Amino acids

      24 to 129
    • Tags

      His tag N-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 24 to 129. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab207145 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Lyophilised
  • Additional notes

     This product was previously labelled as Spasmolytic Polypeptide

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -20°C.

    pH: 7.50
    Constituents: 0.24% Tris, 0.12% Sodium chloride

    Lyophilised from a 0.4 µm filtered solution.

  • Reconstitution
    Add deionized water to prepare a working stock solution of approximately 0.5 mg/mL and let the lyophilised pellet dissolve completely. Aliquot reconstituted protein to avoid repeated freezing/thawing cycles and store at –80°C for long term storage.

General Info

  • Alternative names

    • SML 1
    • SML1
    • SP
    • Spasmolysin
    • Spasmolytic polypeptide
    • spasmolytic protein 1
    • TFF 2
    • TFF2
    • TFF2_HUMAN
    • Trefoil factor 2
    • trefoil factor 2 (spasmolytic protein 1)
    • Trefoil factor 2 precursor
    see all
  • Function

    Inhibits gastrointestinal motility and gastric acid secretion. Could function as a structural component of gastric mucus, possibly by stabilizing glycoproteins in the mucus gel through interactions with carbohydrate side chains.
  • Tissue specificity

    Stomach.
  • Sequence similarities

    Contains 2 P-type (trefoil) domains.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 12% SDS-PAGE analysis of ab207145.
    Lane 1: Reduced and heated sample, 5μg / lane.
    Lane 2: Non-reduced and non-heated sample, 5μg / lane.

References

ab207145 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab207145.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up