Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      MASTSRLDALPRVTCPNHPDAILVEDYRAGDMICPECGLVVGDRVIDVGS EWRTFSNDKATKDPSRVGDSQNPLLSDGDLSTMIGKGTGAASFDEFGNSK YQNRRTMSSSDRAMMNAFKEITTMADRINLPRNIVDRTNNLFKQVYEQKS LKGRANDAIASACLYIACRQEGVPRTFKEICAVSRISKKEIGRCFKLILK ALETSVDLITTGDFMSRFCSNLCLPKQVQMAATHIARKAVELDLVPGRSP ISVAAAAIYMASQASAEKRTQKEIGDIAGVADVTIRQSYRLIYPRAPDLF PTDFKFDTPVDKLPQL
    • Molecular weight
      37 kDa including tags
    • Amino acids
      1 to 316

Specifications

Our Abpromise guarantee covers the use of ab81898 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Western blot

    EMSA

    Other

  • Purity
    > 95 % SDS-PAGE.

  • Form
    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.75% Potassium chloride, 0.0154% DTT, 0.316% Tris HCl, 0.00584% EDTA, 20% Glycerol

General Info

  • Alternative names
    • General transcription factor IIB
    • General transcription factor TFIIB
    • gtf2b
    • RNA polymerase II transcription factor IIB
    • S300 II
    • S300-II
    • TF IIB
    • TF2B
    • TF2B_HUMAN
    • TFIIB
    • Transcription initiation factor IIB
    see all
  • Function
    General factor that plays a major role in the activation of eukaryotic genes transcribed by RNA polymerase II.
  • Sequence similarities
    Belongs to the TFIIB family.
    Contains 1 TFIIB-type zinc finger.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • Anti-TFIIB antibody [IIB1] - ChIP Grade (ab12094) at 1/1000 dilution + Recombinant Human TFIIB protein (ab81898) at 0.01 µg

    Secondary
    Goat Anti-Mouse IgG H&L (HRP) preadsorbed (ab97040) at 1/5000 dilution

    Developed using the ECL technique.

    Performed under reducing conditions.

    Exposure time: 10 seconds

References

ab81898 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab81898.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up