Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MADPDVLTEVPAALKRLAKYVIRGFYGIEHALALDILIRNSCVKEEDMLE LLKFDRKQLRSVLNNLKGDKFIKCRMRVETAADGKTTRHNYYFINYRTLV NVVKYKLDHMRRRIETDERDSTNRASFKCPVCSSTFTDLEANQLFDPMTG TFRCTFCHTEVEEDESAMPKKDARTLLARFNEQIEPIYALLRETEDVNLA YEILEPEPTEIPALKQSKDHAATTAGAASLAGGHHREAWAT KGPSYED LYTQNVVINMDDQEDLHRASLEGKSAKERPIWLRESTVQGAYGSEDMKEG GIDMDAFQEREEGHAGPDDNEEVMRALLIHEKKTSSAMAGSVGAAAPVTA ANGSDSESETSESDDDSPPRPAAVAVHKREEDEEEDDEFEEVADDPIVMV AGRPFSYSEVSQRPELVAQMTPE EKEAYIAMGQRMFEDLFE
    • Molecular weight

      51 kDa including tags
    • Amino acids

      1 to 439
    • Additional sequence information

      NP_005504.2.

Specifications

Our Abpromise guarantee covers the use of ab204777 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 70 % Purified via His tag.
    ab204777 was purified by Immobilized-metal affinity chromatography (IMAC) .
  • Form

    Liquid
  • Additional notes

     This product was previously labelled as TFIIE alpha

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on Dry Ice. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -80°C. Avoid freeze / thaw cycle.

    pH: 7.3
    Preservative: 2.04% Imidazole
    Constituents: 40% Sodium phosphate, 0.87% Sodium chloride

General Info

  • Alternative names

    • FE
    • General transcription factor IIE 56 kDa subunit
    • General transcription factor IIE subunit 1
    • General transcription factor IIE, polypeptide 1, alpha 56kDa
    • Gtf2e1
    • MAL7P1.86
    • T2EA_HUMAN
    • TF2E1
    • TFIIE A
    • TFIIE alpha
    • TFIIE-alpha
    • Transcription initiation factor IIE alpha subunit
    • Transcription initiation factor iie alpha subunit putative
    • Transcription initiation factor IIE subunit alpha
    see all
  • Function

    Recruits TFIIH to the initiation complex and stimulates the RNA polymerase II C-terminal domain kinase and DNA-dependent ATPase activities of TFIIH. Both TFIIH and TFIIE are required for promoter clearance by RNA polymerase.
  • Sequence similarities

    Belongs to the TFIIE alpha subunit family.
    Contains 1 HTH TFE/IIEalpha-type domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • Western blot analysis of ab204777.

  • 10% SDS-PAGE analysis of ab204777 stained with Coomassie Blue.

References

ab204777 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab204777.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up