Overview

  • Product name
    Recombinant Human TFIIIA protein
  • Protein length
    Protein fragment

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      NQQKQYICSFEDCKKTFKKHQQLKIHQCQNTNEPLFKCTQEGCGKHFASP SKLKRHAKAHEGYVCQKGCSFVAKTWTELLKHVRETHKEE
    • Amino acids
      185 to 274
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab158606 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as GTF3A.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • AP 2
    • AP2
    • Factor A
    • General transcription factor 3A
    • General transcription factor IIIA
    • GTF 3A
    • GTF3A
    • TF3A_HUMAN
    • TFIIIA
    • Transcription factor 3A
    • Transcription factor IIIA
    see all
  • Function
    Interacts with the internal control region (ICR) of approximately 50 bases within the 5S RNA genes, is required for correct transcription of these genes by RNA polymerase III. Also binds the transcribed 5S RNA's. May initiate transcription of the 5S ribosomal RNA gene and maintain the stability of transcription of other genes.
  • Tissue specificity
    Ubiquitous.
  • Sequence similarities
    Contains 9 C2H2-type zinc fingers.
  • Cellular localization
    Nucleus.
  • Information by UniProt

Images

  • ab158606 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab158606 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab158606.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up