Description

  • Product name

    Recombinant Human TFPI protein (His tag)
    See all TFPI proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    Purified using conventional chromatography techniques.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Baculovirus infected insect cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ADPDSEEDEEHTIITDTELPPLKLMHSFCAFKADDGPCKAIMKRFFFNIF TRQCEEFIYGGCEGNQNRFESLEECKKMCTRDNANRIIKTTLQQEKPDFC FLEEDPGICRGYITRYFYNNQTKQCERFKYGGCLGNMNNFETLEECKNIC EDGPNGFQVDNYGTQLNAVNNSLTPQSTKVPSLFEFHGPSWCLTPADRGL CRANENRFYYNSVIGKCRPFKYSGCGGNENNFTSKQECLRACKKGFIQRI SKGGLIKTKRKRKKQRVKIAYEEIFVKNMHHHHHH
    • Predicted molecular weight

      33 kDa including tags
    • Amino acids

      29 to 304
    • Tags

      His tag C-Terminus
    • Additional sequence information

      This product is the mature full length protein from aa 29 to 304. The signal peptide is not included.

Specifications

Our Abpromise guarantee covers the use of ab222990 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 10% Glycerol, PBS

General Info

  • Alternative names

    • Anti convertin
    • EPI
    • Extrinsic pathway inhibitor
    • LACI
    • Lipoprotein associated coagulation inhibitor
    • Lipoprotein-associated coagulation inhibitor
    • TFI
    • TFPI
    • TFPI 1
    • TFPI1
    • TFPI1_HUMAN
    • Tissue factor pathway inhibitor
    • Tissue factor pathway inhibitor (lipoprotein associated coagulation inhibitor)
    see all
  • Function

    Inhibits factor X (X(a)) directly and, in a Xa-dependent way, inhibits VIIa/tissue factor activity, presumably by forming a quaternary Xa/LACI/VIIa/TF complex. It possesses an antithrombotic action and also the ability to associate with lipoproteins in plasma.
  • Tissue specificity

    Mostly in endothelial cells.
  • Sequence similarities

    Contains 3 BPTI/Kunitz inhibitor domains.
  • Domain

    This inhibitor contains three inhibitory domains. The first domain interacts with VIIa and TF, the second one with Xa.
  • Post-translational
    modifications

    O-glycosylated.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 3μg of ab222990 was analyzed by 15% SDS-PAGE.

References

ab222990 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab222990.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up