Description

  • Product name

    Recombinant Human TGF alpha protein
    See all TGF alpha proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA
    • Predicted molecular weight

      6 kDa
    • Amino acids

      40 to 89

Specifications

Our Abpromise guarantee covers the use of ab151837 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    HPLC

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    Constituent: 0.06% Acetic acid

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 µg/ml. Dissolve the lyophilized protein in 1X PBS. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.

General Info

  • Alternative names

    • EGF like TGF
    • EGF-like TGF
    • ETGF
    • TFGA
    • TGF A
    • TGF type 1
    • TGF-alpha
    • Tgfa
    • TGFA_HUMAN
    • Transforming growth factor alpha
    • Transforming growth factor alpha precursor
    • Wa1
    • Waved 1
    see all
  • Function

    TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar.
  • Tissue specificity

    Isoform 1, isoform 3 and isoform 4 are expressed in keratinocytes and tumor-derived cell lines.
  • Sequence similarities

    Contains 1 EGF-like domain.
  • Cellular localization

    Cell membrane and Secreted > extracellular space.
  • Information by UniProt

References

ab151837 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab151837.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up