Description

  • Product name

    Recombinant human TGF alpha protein
    See all TGF alpha proteins and peptides
  • Biological activity

    3T3 cell proliferation. ED50 ≤ 2 ng/mL (≥ 5 x 105 units/mg).

  • Purity

    > 95 % SDS-PAGE.

  • Endotoxin level

    <=1.000 Eu/µg
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    Yes
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      VVSHFNDCPDSHTQFCFHGTCRFLVQEDKPACVCHSGYVGARCEHADLLA
    • Predicted molecular weight

      17 kDa
    • Amino acids

      40 to 89

Associated products

Specifications

Our Abpromise guarantee covers the use of ab233681 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at Room Temperature. Store at -20°C long term.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80°C and avoid repeat freeze thaws.

General Info

  • Alternative names

    • EGF like TGF
    • EGF-like TGF
    • ETGF
    • TFGA
    • TGF A
    • TGF type 1
    • TGF-alpha
    • Tgfa
    • TGFA_HUMAN
    • Transforming growth factor alpha
    • Transforming growth factor alpha precursor
    • Wa1
    • Waved 1
    see all
  • Function

    TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar.
  • Tissue specificity

    Isoform 1, isoform 3 and isoform 4 are expressed in keratinocytes and tumor-derived cell lines.
  • Sequence similarities

    Contains 1 EGF-like domain.
  • Cellular localization

    Cell membrane and Secreted > extracellular space.
  • Information by UniProt

Images

  • SDS-PAGE - Recombinant human TGF alpha protein (Active) (ab233681) at 1 µg.

    Lane 1: Non-reducing conditions.

    Lane 2: Reducing conditions.

    4-20% Tris-Glycine gel stained with Coomassie Blue.

  • Human TGF alpha (ab233681) induced proliferation of NIH/3T3 (mouse embryo fibroblast cell line) cells.

References

ab233681 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab233681.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up