Recombinant Human TGF beta 1 protein (ab130946)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 98% SDS-PAGE
- Suitable for: SDS-PAGE, HPLC
Description
-
Product name
Recombinant Human TGF beta 1 protein
See all TGF beta 1 proteins and peptides -
Purity
> 98 % SDS-PAGE.
> 98% by HPLC -
Expression system
HEK 293 cells -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPY IWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQ LSNMIVRSCKCS -
Predicted molecular weight
13 kDa -
Amino acids
279 to 390
-
Associated products
-
Related Products
Specifications
Our Abpromise guarantee covers the use of ab130946 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
HPLC
-
Form
Lyophilized -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. After reconstitution store at -20ºC. Avoid freeze / thaw cycles.
Constituent: 0.1% Trifluoroacetic acid
-
ReconstitutionResuspend in 10 mM citric acid pH 3.0 to a concentration of 0.1-1.0 mg/ml. Do not vortex. For extended storage dilute further in a buffer containing a carrier protein (for example 0.1% BSA). Store reconstituted protein at -20°C. Avoid repeated thawing and freezing.
General Info
-
Alternative names
- Cartilage-inducing factor
- CED
- Differentiation inhibiting factor
see all -
Function
Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone remodeling as it is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts. -
Tissue specificity
Highly expressed in bone. Abundantly expressed in articular cartilage and chondrocytes and is increased in osteoarthritis (OA). Co-localizes with ASPN in chondrocytes within OA lesions of articular cartilage. -
Involvement in disease
Defects in TGFB1 are the cause of Camurati-Engelmann disease (CE) [MIM:131300]; also known as progressive diaphyseal dysplasia 1 (DPD1). CE is an autosomal dominant disorder characterized by hyperostosis and sclerosis of the diaphyses of long bones. The disease typically presents in early childhood with pain, muscular weakness and waddling gait, and in some cases other features such as exophthalmos, facial paralysis, hearing difficulties and loss of vision. -
Sequence similarities
Belongs to the TGF-beta family. -
Post-translational
modificationsGlycosylated.
The precursor is cleaved into mature TGF-beta-1 and LAP, which remains non-covalently linked to mature TGF-beta-1 rendering it inactive. -
Cellular localization
Secreted > extracellular space > extracellular matrix. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab130946 has not yet been referenced specifically in any publications.