Description

  • Product name

    Recombinant human TGF beta 1 protein (Animal Free)
    See all TGF beta 1 proteins and peptides
  • Biological activity

    Determined by TGF beta 1’s ability to inhibit the mouse IL-4-dependent proliferation of mouse HT-2 cells.  The expected ED50 is ≤ 0.05 ng/mL, corresponding to a specific activity of ≥ 2 x 107 units/mg.

  • Purity

    > 98 % SDS-PAGE.
    > 98% by HPLC analysis.
  • Expression system

    CHO cells
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    Yes
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPY IWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQ LSNMIVRSCKCS
    • Predicted molecular weight

      25 kDa
    • Amino acids

      279 to 390
    • Additional sequence information

      Two identical 112 amino acid polypeptide chains linked by a single disulfide bond.

Specifications

Our Abpromise guarantee covers the use of ab217396 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    This product is an active protein and may elicit a biological response in vivo, handle with caution.

  • Reconstitution
    For lot specific reconstitution information please contact our Scientific Support Team.

General Info

  • Alternative names

    • Cartilage-inducing factor
    • CED
    • Differentiation inhibiting factor
    • DPD1
    • LAP
    • Latency-associated peptide
    • Prepro transforming growth factor beta 1
    • TGF beta
    • TGF beta 1
    • TGF beta 1 protein
    • TGF-beta 1 protein
    • TGF-beta-1
    • TGF-beta-5
    • TGF-beta1
    • TGFB
    • Tgfb-1
    • tgfb1
    • TGFB1_HUMAN
    • TGFbeta
    • TGFbeta1
    • Transforming Growth Factor b1
    • Transforming Growth Factor beta 1
    • Transforming growth factor beta 1a
    • transforming growth factor beta-1
    • transforming growth factor, beta 1
    • Transforming Growth Factor-ß1
    see all
  • Function

    Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negatively regulates many other growth factors. It plays an important role in bone remodeling as it is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts.
  • Tissue specificity

    Highly expressed in bone. Abundantly expressed in articular cartilage and chondrocytes and is increased in osteoarthritis (OA). Co-localizes with ASPN in chondrocytes within OA lesions of articular cartilage.
  • Involvement in disease

    Defects in TGFB1 are the cause of Camurati-Engelmann disease (CE) [MIM:131300]; also known as progressive diaphyseal dysplasia 1 (DPD1). CE is an autosomal dominant disorder characterized by hyperostosis and sclerosis of the diaphyses of long bones. The disease typically presents in early childhood with pain, muscular weakness and waddling gait, and in some cases other features such as exophthalmos, facial paralysis, hearing difficulties and loss of vision.
  • Sequence similarities

    Belongs to the TGF-beta family.
  • Post-translational
    modifications

    Glycosylated.
    The precursor is cleaved into mature TGF-beta-1 and LAP, which remains non-covalently linked to mature TGF-beta-1 rendering it inactive.
  • Cellular localization

    Secreted > extracellular space > extracellular matrix.
  • Information by UniProt

References

ab217396 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab217396.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up