Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      MHYCVLSAFLILHLVTVALSLSTCSTLDMDQFMRKRIEAIRGQILSKLKL TSPPEDYPEPEEVPPEVISIYNSTRDLLQEKASRRAAACERERSDEEYYA KEVYKIDMPPFFPSENAIPPTFYRPYFRIVRFDVSAMEKNASNLVKAEFR VFRLQNPKARVPEQRIELYQILKSKDLTSPTQRYIDSKVVKTRAEGEWLS FDVTDAVHEWLHHKDRNLGFKISLHCPCCTFVPSNNYIIPNKSEELEARF AGIDGTSTYTSGDQKTIKSTRKKNSGKTPHLLLMLLPSYRLESQQTNRRK KRALDAAYCFRNVQDNCCLRPLYIDFKRDLGWKWIHEPKGYNANFCAGAC PYLWSSDTQHSRVLSLYNTINPEASASPCCVSQDLEPLTILYYIGKTPKI EQLSNMIVKSCKCS
    • Molecular weight
      74 kDa including tags
    • Amino acids
      1 to 414
    • Tags
      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159690 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • BSC-1 cell growth inhibitor
    • BSC1 cell growth inhibitor
    • Cetermin
    • G-TSF
    • Glioblastoma-derived T-cell suppressor factor
    • GTSF
    • LAP
    • Latency-associated peptide
    • MGC116892
    • MGF
    • Milk growth factor
    • Polyergin
    • TGF-beta-2
    • TGF-beta2
    • TGFB2
    • TGFB2_HUMAN
    • Transforming growth factor beta 2
    see all
  • Function
    TGF-beta 2 has suppressive effects on interleukin-2 dependent T-cell growth.
  • Involvement in disease
    A chromosomal aberration involving TGFB2 is found in a family with Peters anomaly. Translocation t(1;7)(q41;p21) with HDAC9.
    Loeys-Dietz syndrome 4
    Defects in TGFB2 may be a cause of non-syndromic aortic disease (NSAD). NSAD is a frequently asymptomatic but potentially lethal disease characterized by thoracic aortic aneurysms and dissections without additional syndromic features.
  • Sequence similarities
    Belongs to the TGF-beta family.
  • Post-translational
    modifications
    The precursor is cleaved into mature TGF-beta-2 and LAP, which remains non-covalently linked to mature TGF-beta-2 rendering it inactive.
  • Cellular localization
    Secreted.
  • Information by UniProt

Images

  • ab159690 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159690 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159690.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up