Description

  • Product name

    Recombinant Human TGF beta 3 protein (denatured)
    See all TGF beta 3 proteins and peptides
  • Purity

    > 85 % SDS-PAGE.
    ab202611 was purified by using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSLSTCTTLDFGHIKKKRVEAIRGQILSK LRLTSPPEPTVMTHVPYQVLALYNSTRELLEEMHGEREEGCTQENTESEY YAKEIHKFDMIQGLAEHNELAVCPKGITSKVFRFNVSSVEKNRTNLFRAE FRVLRVPNPSSKRNEQRIELFQILRPDEHIAKQRYIGGKNLPTRGTAEWL SFDVTDTVREWLLRRESNLGLEISIHCPCHTFQPNGDILENIHEVMEIKF KGVDNEDDHGRGDLGRLKKQKDHHNPHLILMMIPPHRLDNPGQGGQRKKR ALDTNYCFRNLEENCCVRPLYIDFRQDLGWKWVHEPKGYYANFCSGPCPY LRSADTTHSTVLGLYNTLNPEASASPCCVPQDLEPLTILYYVGRTPKVEQ LSNMVVKSCKCS
    • Predicted molecular weight

      47 kDa including tags
    • Amino acids

      24 to 412
    • Tags

      His tag N-Terminus
    • Additional sequence information

      Mature protein without the signal peptide. NP_003230.
  • Description

    Recombinant Human TGF beta 3 protein

Specifications

Our Abpromise guarantee covers the use of ab202611 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 10% Glycerol, 0.32% Tris HCl

General Info

  • Alternative names

    • ARVD
    • ARVD1
    • FLJ16571
    • LDS5
    • MGC105479
    • MGC118722
    • prepro-transforming growth factor beta-3
    • RNHF
    • TGF beta 3
    • TGF beta3
    • TGF-beta-3
    • TGFB 3
    • Tgfb3
    • TGFB3_HUMAN
    • transforming growth factor beta 3
    • Transforming growth factor beta-3
    see all
  • Function

    Involved in embryogenesis and cell differentiation.
  • Involvement in disease

    Defects in TGFB3 are a cause of familial arrhythmogenic right ventricular dysplasia type 1 (ARVD1) [MIM:107970]; also known as arrhythmogenic right ventricular cardiomyopathy 1 (ARVC1). ARVD is an autosomal dominant disease characterized by partial degeneration of the myocardium of the right ventricle, electrical instability, and sudden death. It is clinically defined by electrocardiographic and angiographic criteria; pathologic findings, replacement of ventricular myocardium with fatty and fibrous elements, preferentially involve the right ventricular free wall.
  • Sequence similarities

    Belongs to the TGF-beta family.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab202611 (3μg).

References

ab202611 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202611.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up