Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MMSIKAFTLVSAVERELLMGDKERVNIECVECCGRDLYVGTNDCFVYHFL LEERPVPAGPATFTATKQLQRHLGFKKPVNELRAASALNRLLVLCDNSIS LVNMLNLEPVPSGARIKGAATFALNENPVSGDPFCVEVCIISVKRRTIQM FLVYEDRVQIVKEVSTAEQPLAVAVDGHFLCLALTTQYIIHNYSTGVSQD LFPYCSEERPPIVKRIGRQEFLLAGPGGLGMFATVAGISQRAPVHWSENV IGAAVSFPYVIALDDEFITVHSMLDQQQKQTLPFKEGHILQDFEGRVIVA TSKGVYILVPLPLEKQIQDLLASRRVEEALVLAKGARRNIPKEKFQVMYR RILQQAGFIQFAQLQFLEAKELFRSGQLDVRELISLYPFLLPTSSSFTRS HPPLHEYADLNQLTQGDQEKMAKCKRFLMSYLNEVRSTEVANGYKEDIDT ALLKLYAEADHDSLLDLLVTENFCLLTDSAAWLEKHKKYFALGLLYHYNN QDAAAVQLWVNIVNGDVQDSTRSDLYEYIVDFLTYCLDEELVWAYADWVL QKSEEVGVQVFTKRPLDEQQKNSFNPDDIINCLKKYPKALVKYLEHLVID KRLQKEEYHTHLAVLYLEEVLLQRASASGKGAEATETQAKLRRLLQKSDL YRVHFLLERLQGAGLPTESAILHGKLGEHEKALHILVHELQDFAAAEDYC LWCSEGRDPPHRQQLFHTLLAIYLHAGPTAHELAVAAVDLLNRHATEFDA AQVLQMLPDTWSVQLLCPFLMGAMRDSIHARRTMQVALGLARSENLIYTY DKMKLKGSSIQLSDKKLCQICQNPFCEPVFVRYPNGGLVHTHCAASRHTN PSSSSPGTRT
    • Amino acids

      1 to 860
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab160467 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as TGF-beta receptor-associated protein 1.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • TGF-beta receptor-associated protein 1
    • TGFA1_HUMAN
    • Tgfbrap1
    • Transforming growth factor-beta receptor-associated protein 1
    • TRAP-1
    • TRAP1
    • VPS3
    see all
  • Function

    Plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling. May recruit SMAD4 to the vicinity of the receptor complex and facilitate its interaction with receptor-regulated Smads, such as SMAD2.
  • Sequence similarities

    Belongs to the TRAP1 family.
    Contains 1 CNH domain.
  • Cellular localization

    Cytoplasm. Colocalizes with TGF-beta receptors in the absence of signaling.
  • Information by UniProt

Images

  • ab160467 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab160467 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

Application
Other
The effect of recombinant protein on cell viability is assessed with MTS viability determination method on cultured CHO-M2 cells for 42h in presence of different concentrations (45.5 – 22.7 – 11.4 – 5.7 – 2.8 – 1.4 nM) of rTRAP-1.

CONCLUSION
We observe a slight decline of cell viability for the highest concentration of rTRAP-1 (45.5nM).

Abcam user community

Verified customer

Submitted Aug 26 2016

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up