Overview

Description

  • Nature
    Recombinant
  • Source
    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species
      Human
    • Sequence
      RGSHHHHHHGMASMTGGQQMGRDLYDDDDKDRWGSKRLQKEEYHTHLAVL YLEEVLLQRASASGKGAEATETQAKLRRLLQKSDLYRVHFLLERLQGAGL PMESAILHGKLGEHEKALHILVHELQDFAAAEDYCLWCSEGRDPPHRQQL FHTLLAIYLHAGPTAHELAVAAVDLLNRHATEFDAAQVLQMLPDTWSVQL LCPFLMGAMRDSIHARRTMQVALGLARSENLIYTYDKMKLKGSSIQLSDK KLCQICQNPFCEPVFVRYPNGGLVHTHCAASRHTNPSSSSPGTRT
    • Molecular weight
      33 kDa including tags
    • Amino acids
      601 to 860
    • Tags
      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab177603 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity
    > 80 % SDS-PAGE.
    ab177603 was purified by using anion-exchange chromatography (DEAE sepharose resin) and gel-filtration chromatography.
  • Form
    Liquid
  • Additional notes

    Previously labelled as TGF-beta receptor-associated protein 1.

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    Information available upon request.

General Info

  • Alternative names
    • TGF-beta receptor-associated protein 1
    • TGFA1_HUMAN
    • Tgfbrap1
    • Transforming growth factor-beta receptor-associated protein 1
    • TRAP-1
    • TRAP1
    • VPS3
    see all
  • Function
    Plays a role in the TGF-beta/activin signaling pathway. It associates with inactive heteromeric TGF-beta and activin receptor complexes, mainly through the type II receptor, and is released upon activation of signaling. May recruit SMAD4 to the vicinity of the receptor complex and facilitate its interaction with receptor-regulated Smads, such as SMAD2.
  • Sequence similarities
    Belongs to the TRAP1 family.
    Contains 1 CNH domain.
  • Cellular localization
    Cytoplasm. Colocalizes with TGF-beta receptors in the absence of signaling.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab177603 (3µg).

References

ab177603 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab177603.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up