Description

  • Product name

    Recombinant Human TGIF2 protein
  • Expression system

    Wheat germ
  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MSDSDLGEDEGLLSLAGKRKRRGNLPKESVKILRDWLYLHRYNAYPSEQE KLSLSGQTNLSVLQICNWFINARRRLLPDMLRKDGKDPNQFTISRRGGKA SDVALPRGSSPSVLAVSVPAPTNVLSLSVCSMPLHSGQGEKPAAPFPRGE LESPKPLVTPGSTLTLLTRAEAGSPTGGLFNTPPPTPPEQDKEDFSSFQL LVEVALQRAAEMELQKQQDPSLPLLHTPIPLVSENPQ
    • Amino acids

      1 to 237
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab163717 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.

    Previously labelled as TGF beta induced factor 2. 

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • 5' TG 3' interacting factor 2
    • 5''-TG-3''-interacting factor 2
    • Homeobox protein TGIF2
    • TGF (beta) induced transcription factor 2
    • TGF beta induced factor 2
    • TGF-beta-induced transcription factor 2
    • TGFB induced factor 2
    • TGFB-induced factor 2
    • Tgif2
    • TGIF2_HUMAN
    • Transforming growth factor beta induced factor 2
    see all
  • Function

    Transcriptional repressor, which probably repress transcription by binding directly the 5'-CTGTCAA-3' DNA sequence or by interacting with TGF-beta activated SMAD proteins. Probably represses transcription via the recruitment of histone deacetylase proteins.
  • Tissue specificity

    Widely expressed. Highly expressed in heart, kidney and testis. Weakly expressed in brain and prostate.
  • Sequence similarities

    Belongs to the TALE/TGIF homeobox family.
    Contains 1 homeobox DNA-binding domain.
  • Post-translational
    modifications

    The C-terminal part is phosphorylated in response to EGF signaling by the Ras/MAPK pathway.
  • Cellular localization

    Nucleus. Excluded from nucleoli.
  • Information by UniProt

Images

  • ab163717 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab163717 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab163717.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up