Overview

Description

  • Nature
    Recombinant
  • Source
    Wheat germ
  • Amino Acid Sequence
    • Species
      Human
    • Sequence
      QGPIDGPSKSGAEEQTSKDSPNKVVPEQPSRKDHSKPISNPSDNKELPKA DTNQLADKGKLSPHAFKTESGEETDLISPPQEEVKSSEPTEDVEPKEAE
    • Amino acids
      229 to 327
    • Tags
      proprietary tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab161074 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    ELISA

  • Form
    Liquid
  • Additional notes
    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names
    • TGN 46
    • TGN 51
    • TGN38
    • TGN38 homolog
    • TGN38B
    • TGN46
    • TGN48
    • TGN51
    • TGOLN2
    • TGON2_HUMAN
    • Trans Golgi network integral membrane protein 2
    • Trans golgi network protein 2
    • Trans Golgi network protein TGN51
    • Trans-Golgi network integral membrane protein 2
    • Trans-Golgi network protein TGN51
    • TTGN2
    see all
  • Function
    May be involved in regulating membrane traffic to and from trans-Golgi network.
  • Tissue specificity
    Isoform TGN46 is widely expressed. Isoform TGN51 is more abundant in fetal lung and kidney. Isoform TGN48 is barely expressed in embryonic kidney and promyelocytic cells.
  • Cellular localization
    Cell membrane. Golgi apparatus > trans-Golgi network membrane. Primarily in trans-Golgi network. Cycles between the trans-Golgi network and the cell surface returning via endosomes.
  • Information by UniProt

Images

  • ab161074 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab161074 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab161074.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY AND ARE NOT INTENDED FOR DIAGNOSTIC OR THERAPEUTIC USE"

Sign up