Overview

  • Product name

    Recombinant Human TGT protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSEFMAGAATQASLESAPRIMRLVAECSR SRARAGELWLPHGTVATPVFMPVGTQATMKGITTEQLDALGCRICLGNTY HLGLRPGPELIQKANGLHGFMNWPHNLLTDSGGFQMVSLVSLSEVTEEGV RFRSPYDGNETLLSPEKSVQIQNALGSDIIMQLDDVVSSTVTGPRVEEAM YRSIRWLDRCIAAHQRPDKQNLFAIIQGGLDADLRATCLEEMTKRDVPGF AIGGLSGGESKSQFWRMVALSTSRLPKDKPRYLMGVGYATDLVVCVALGC DMFDCVFPTRTARFGSALVPTGNLQLRKKVFEKDFGPIDPECTCPTCQKH SRAFLHALLHSDNTAALHHLTVHNIAYQLQLMSAVRTSIVEKRFPDFVRD FMGAMYGDPTLCPTWATDALASVGITLG
    • Molecular weight

      47 kDa including tags
    • Amino acids

      1 to 403
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_112486.

Specifications

Our Abpromise guarantee covers the use of ab202188 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 80 % SDS-PAGE.
    ab202188 was purified using conventional chromatography techniques.
  • Form

    Liquid
  • Additional notes

     This product was previously labelled as QTRT1

     

  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.4
    Constituents: 30% Glycerol, 0.02% DTT, 69% PBS

General Info

  • Alternative names

    • FP3235
    • Guanine insertion enzyme
    • qtrt1
    • Queuine tRNA ribosyltransferase
    • Queuine tRNA ribosyltransferase 1
    • Queuine tRNA-ribosyltransferase
    • TGT
    • TGT, 43 KD subunit
    • TGT, catalytic subunit
    • TGT_HUMAN
    • TGUT
    • tRNA guanine transglycosylase
    • tRNA-guanine transglycosylase
    see all
  • Function

    Interacts with QTRTD1 to form an active queuine tRNA-ribosyltransferase. This enzyme exchanges queuine for the guanine at the wobble position of tRNAs with GU(N) anticodons (tRNA-Asp, -Asn, -His and -Tyr), thereby forming the hypermodified nucleoside queuosine (Q) (7-(((4,5-cis-dihydroxy-2-cyclopenten-1-yl)amino)methyl)-7-deazaguanosine).
  • Pathway

    tRNA modification; tRNA-queuosine biosynthesis.
  • Sequence similarities

    Belongs to the queuine tRNA-ribosyltransferase family.
  • Cellular localization

    Cytoplasm. Mitochondrion. Nucleus. Weakly associates with mitochondria, possibly via QTRTD1.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of ab202188 (3 μg).

References

ab202188 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202188.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up