Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MAGAVPGAIMDEDYYGSAAEWGDEADGGQQEDDSGEGEDDAEVQQECLHK FSTRDYIMEPSIFNTLKRYFQAGGSPENVIQLLSENYTAVAQTVNLLAEW LIQTGVEPVQVQETVENHLKSLLIKHFDPRKADSIFTEEGETPAWLEQMI AHTTWRDLFYKLAEAHPDCLMLNFTVKLISDAGYQGEITSVSTACQQLEV FSRVLRTSLATILDGGEENLEKNLPEFAKMVCHGEHTYLFAQAMMSVLAQ EEQGGSAVRRIAQEVQRFAQEKGHDASQITLALGTAASYPRACQALGAML SKGALNPADITVLFKMFTSMDPPPVELIRVPAFLDLFMQSLFKPGARINQ DHKHKYIHILAYAASVVETWKKNKRVSINKDELKSTSKAVETVHNLCCNE NKGASELVAELSTLYQCIRFPVVAMGVLKWVDWTVSEPRYFQLQTDHTPV HLALLDEISTCHQLLHPQVLQLLVKLFETEHSQLDVMEQLELKKTLLDRM VHLLSRGYVLPVVSYIRKCLEKLDTDISLIRYFVTEVLDVIAPPYTSDFV QLFLPILENDSIAGTIKTEGEHDPVTEFIAHCKSNFIMVN
    • Amino acids

      1 to 590
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab162576 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • HSPC130
    • Negative elongation factor C/D
    • NELF C
    • NELF D
    • NELF-C/D
    • NELFC
    • NELFD
    • NELFD_HUMAN
    • TH1
    • TH1-like protein
    • TH1L
    see all
  • Function

    Essential component of the NELF complex, a complex that negatively regulates the elongation of transcription by RNA polymerase II. The NELF complex, which acts via an association with the DSIF complex and causes transcriptional pausing, is counteracted by the P-TEFb kinase complex.
  • Tissue specificity

    Widely expressed. Expressed in heart, brain, lung, placenta, liver, skeletal and cardiac muscle, adrenal, thyroid, kidney and pancreas.
  • Sequence similarities

    Belongs to the NELF-D family.
  • Cellular localization

    Nucleus.
  • Information by UniProt

Images

  • ab162576 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab162576 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab162576.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up