Description

  • Product name

    Recombinant Human THAP11 protein
    See all THAP11 proteins and peptides
  • Purity

    > 90 % SDS-PAGE.
    ab169918 was expressed in E.coli as inclusion bodies then refolded using “temperature shift inclusion body refolding” technology and chromatographically purified.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      GEFPGFTCCVPGCYNNSHRDKALHFYTFPKDAELRRLWLKNVSRAGVSGC FSTFQ PTTGHRLCSVHFQGGRKTYTVRVPTIFPLRGVNERKVARRPAG AAAARRRQQQQQQQQQQQQQQ QQQQQQQQQQQQQQQSSPSASTAQTAQ LQPNLVSASAAVLLTLQATVDSSQAPGSVQPAPITPT GEDVKPIDLTV QVEFAAAEGAAAAAAASELQAATAGLEAAECPMGPQLVVVGEEGFPDTGS DHS YSLSSGTTEEELLRKLNEQRDILALMEVKMKEMKGSIRHLRLTEA KLREELREKDRLLAMAVIR KKHGMLEESGGGGSPGRRRRRRRRRRR
    • Predicted molecular weight

      37 kDa
    • Amino acids

      1 to 314
    • Tags

      T7 tag C-Terminus , proprietary tag C-Terminus

Associated products

Specifications

Our Abpromise guarantee covers the use of ab169918 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Additional notes

    Buffer contains NaCl, KCl, EDTA, arginine, DTT and Glycerol.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at -80°C.

    pH: 8.00
    Constituent: 0.32% Tris HCl
    Note: Proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.

General Info

  • Alternative names

    • CTG B43a
    • CTG B45d
    • HRIHFB2206
    • RONIN
    • THA11_HUMAN
    • THAP 11
    • THAP domain containing 11
    • THAP domain-containing protein 11
    • Thap11
    see all
  • Function

    Transcriptional repressor that plays a central role for embryogenesis and the pluripotency of embryonic stem (ES) cells. Sequence-specific DNA-binding factor that represses gene expression in pluripotent ES cells by directly binding to key genetic loci and recruiting epigenetic modifiers.
  • Sequence similarities

    Belongs to the THAP11 family.
    Contains 1 THAP-type zinc finger.
  • Cellular localization

    Nucleus. Cytoplasm. May be regulated by shuttling of the protein between the cytoplasm and nucleus.
  • Information by UniProt

References

ab169918 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab169918.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up