Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMPGFTCCVPGCYNNSHRDKALHFYTFP KDAELRRLWLKNVSRAGVSGCFSTFQPTTGHRLCSVHFQGGRKTYTVRVP TIFPLRGVNERKVARRPAGAAAARRRQQQQQQQQQQQQQQQQQQQQQQQQ QQQQQSSPSASTAQTAQLQPNLVSASAAVLLTLQATVDSSQAPGSVQPAP ITPTGEDVKPIDLTVQVEFAAAEGAAAAAAASELQAATAGLEAAECPMGP QLVVVGEEGFPDTGSDHSYSLSSGTTEEELLRKLNEQRDILALMEVKMKE MKGSIRHLRLTEAKLREELREKDRLLAMAVIRKKHGM
    • Molecular weight

      37 kDa including tags
    • Amino acids

      1 to 314
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_065190

Specifications

Our Abpromise guarantee covers the use of ab180329 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Purity

    > 80 % SDS-PAGE.

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.0
    Constituents: 10% Glycerol, 2.4% Urea, 0.32% Tris HCl

General Info

  • Alternative names

    • CTG B43a
    • CTG B45d
    • HRIHFB2206
    • RONIN
    • THA11_HUMAN
    • THAP 11
    • THAP domain containing 11
    • THAP domain-containing protein 11
    • Thap11
    see all
  • Function

    Transcriptional repressor that plays a central role for embryogenesis and the pluripotency of embryonic stem (ES) cells. Sequence-specific DNA-binding factor that represses gene expression in pluripotent ES cells by directly binding to key genetic loci and recruiting epigenetic modifiers.
  • Sequence similarities

    Belongs to the THAP11 family.
    Contains 1 THAP-type zinc finger.
  • Cellular localization

    Nucleus. Cytoplasm. May be regulated by shuttling of the protein between the cytoplasm and nucleus.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3µg ab180329.

References

ab180329 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab180329.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up