Description

  • Product name

    Recombinant Human THAP7 protein (denatured)
    See all THAP7 proteins and peptides
  • Purity

    > 85 % SDS-PAGE.

  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMPRHCSAAGCCTRDTRETRNRGISFHR LPKKDNPRRGLWLANCQRLDPSGQGLWDPASEYIYFCSKHFEEDCFELVG ISGYHRLKEGAVPTIFESFSKLRRTTKTKGHSYPPGPAEVSRLRRCRKRC SEGRGPTTPFSPPPPADVTCFPVEEASAPATLPASPAGRLEPGLSSPFSD LLGPLGAQADEAGCSAQPSPERQPSPLEPRPVSPSAYMLRLPPPAGAYIQ NEHSYQVGSALLWKRRAEAALDALDKAQRQLQACKRREQRLRLRLTKLQQ ERAREKRAQADARQTLKEHVQDFAMQLSSSMA
    • Predicted molecular weight

      37 kDa including tags
    • Amino acids

      1 to 309
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_001008695
  • Description

    Recombinant Human THAP7 protein

Specifications

Our Abpromise guarantee covers the use of ab181931 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8
    Constituents: 0.32% Tris HCl, 10% Glycerol, 2.4% Urea

General Info

  • Alternative names

    • 1810004B07Rik
    • THAP domain containing 7
    • THAP domain-containing protein 7
    • Thap7
    • THAP7_HUMAN
    see all
  • Function

    Chromatin-associated, histone tail-binding protein that represses transcription via recruitment of HDAC3 and nuclear hormone receptor corepressors.
  • Sequence similarities

    Contains 1 THAP-type zinc finger.
  • Cellular localization

    Nucleus. Chromosome.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab181931.

References

ab181931 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab181931.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up