Description

  • Product name

    Recombinant Human THEM2 protein
  • Purity

    > 95 % SDS-PAGE.
    ab101158 is purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMTSMTQSLREVIKAMTKARNFERVLGKITL VSAAPGKVICEMKVEEEHTNAIGTLHGGLTATLVDNISTMALLCTERGAP GVSVDMNITYMSPAKLGEDIVITAHVLKQGKTLAFTSVDLTNKATGKLIA QGRHTKHLGN
    • Predicted molecular weight

      17 kDa including tags
    • Amino acids

      1 to 140
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab101158 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • 15 Kd protein
    • ACO13_HUMAN
    • Acot13
    • Acyl-CoA thioesterase 13
    • Acyl-coenzyme A thioesterase 13
    • HT012
    • hypothalamus protein HT012
    • MGC4961
    • PNAS 27
    • PNAS27
    • Thioesterase superfamily member 2
    see all
  • Function

    Acyl-CoA thioesterases are a group of enzymes that catalyze the hydrolysis of acyl-CoAs to the free fatty acid and coenzyme A (CoASH), providing the potential to regulate intracellular levels of acyl-CoAs, free fatty acids and CoASH. Has acyl-CoA thioesterase activity towards medium (C12) and long-chain (C18) fatty acyl-CoA substrates. Can also hydrolyze 3-hydroxyphenylacetyl-CoA and 3,4-dihydrohyphenylacetyl-CoA (in vitro).
  • Sequence similarities

    Belongs to the thioesterase PaaI family.
  • Cellular localization

    Cytoplasm. Mitochondrion.
  • Information by UniProt

Images

  • 15% SDS-PAGE showing ab101158 at approximately 17.1kDa (3µg).

References

ab101158 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab101158.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up