Recombinant Human Thioredoxin / TRX protein (ab172159)
Key features and details
- Expression system: Escherichia coli
- Purity: > 95% SDS-PAGE
- Tags: His tag N-Terminus
- Suitable for: SDS-PAGE, HPLC
Description
-
Product name
Recombinant Human Thioredoxin / TRX protein
See all Thioredoxin / TRX proteins and peptides -
Purity
> 95 % SDS-PAGE.
Greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE. -
Endotoxin level
1.000 Eu/µg -
Expression system
Escherichia coli -
Accession
-
Protein length
Full length protein -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
MGSSHHHHHHSSGLVPRGSHMVKQIESKTAFQEALDAAGDKLVVVDFSAT WCGPCKMIKPFFHSL SEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKE KLEATINELV -
Predicted molecular weight
12 kDa -
Amino acids
1 to 105 -
Tags
His tag N-Terminus
-
Associated products
-
Related Products
- Anti-Thioredoxin / TRX antibody [EPR6111] (ab109385)
- Anti-Thioredoxin / TRX antibody (ab115758)
- Anti-Thioredoxin / TRX antibody [EPR6110] (ab133524)
- Anti-6X His tag® antibody [HIS.H8] (ab18184)
- Anti-Thioredoxin / TRX antibody (ab26320)
- Anti-6X His tag® antibody [4D11] (ab5000)
- Anti-Thioredoxin / TRX antibody (ab86255)
- Anti-6X His tag® antibody (ab9108)
Specifications
Our Abpromise guarantee covers the use of ab172159 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
HPLC
-
Form
Liquid -
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped on Dry Ice. Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.
pH: 7.2
Constituent: 100% PBS
Supplied as a 0.2 µM filtered solution.
General Info
-
Alternative names
- ADF
- ATL derived factor
- ATL-derived factor
see all -
Function
Participates in various redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. Plays a role in the reversible S-nitrosylation of cysteine residues in target proteins, and thereby contributes to the response to intracellular nitric oxide. Nitrosylates the active site Cys of CASP3 in response to nitric oxide (NO), and thereby inhibits caspase-3 activity. Induces the FOS/JUN AP-1 DNA-binding activity in ionizing radiation (IR) cells through its oxidation/reduction status and stimulates AP-1 transcriptional activity.
ADF augments the expression of the interleukin-2 receptor TAC (IL2R/P55). -
Sequence similarities
Belongs to the thioredoxin family.
Contains 1 thioredoxin domain. -
Post-translational
modificationsIn the fully reduced protein, both Cys-69 and Cys-73 are nitrosylated in response to nitric oxide (NO). When two disulfide bonds are present in the protein, only Cys-73 is nitrosylated. Cys-73 can serve as donor for nitrosylation of target proteins.
In case of infection, ubiquitinated by S.typhimurium protein slrP, leading to its degradation. -
Cellular localization
Nucleus. Cytoplasm. Secreted. Secreted by a leaderless secretory pathway. Predominantly in the cytoplasm in non irradiated cells. Radiation induces translocation of TRX from the cytoplasm to the nucleus. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
Datasheets and documents
References (0)
ab172159 has not yet been referenced specifically in any publications.