Overview

  • Product name

    Recombinant Human THOC7 protein
  • Protein length

    Full length protein

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMGSMGAVTDDEVIRKRLLIDGDGAGDDRRI NLLVKSFIKWCNSGSQEEGYSQYQRMLSTLSQCEFSMGKTLLVYDMNLRE MENYEKIYKEIECSIAGAHEKIAECKKQILQAKRIRKNRQEYDALAKVIQ HHPDRHETLKELEALGKELEHLSHIKESVEDKLELRRKQFHVLLSTIHEL QQTLENDEKLSEVEEAQEASMETDPKP
    • Molecular weight

      26 kDa including tags
    • Amino acids

      1 to 204
    • Tags

      His tag N-Terminus
    • Additional sequence information

      NP_079351.

Specifications

Our Abpromise guarantee covers the use of ab202166 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Mass Spectrometry

    SDS-PAGE

  • Mass spectrometry

    MALDI-TOF
  • Purity

    > 90 % SDS-PAGE.
    ab202166 was purified using conventional chromatography techniques.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 7.40
    Constituents: 49% PBS, 50% Glycerol, 0.02% DTT

General Info

  • Alternative names

    • FLJ23445
    • fSAP24
    • Functional spliceosome associated protein 24
    • Functional spliceosome-associated protein 24
    • hTREX30
    • Ngg1 interacting factor 3 like 1 binding protein 1
    • Ngg1 interacting factor 3 like protein 1 binding protein 1
    • Ngg1-interacting factor 3-like protein 1-binding protein 1
    • NIF3L1 binding protein 1
    • NIF3L1-binding protein 1
    • NIF3L1BP1
    • THO complex 7 homolog
    • THO complex 7 homolog (Drosophila)
    • THO complex subunit 7 homolog
    • THOC 7
    • thoc7
    • THOC7_HUMAN
    see all
  • Function

    Component of the THO subcomplex of the TREX complex. The TREX complex specifically associates with spliced mRNA and not with unspliced pre-mRNA. It is recruited to spliced mRNAs by a transcription-independent mechanism. Binds to mRNA upstream of the exon-junction complex (EJC) and is recruited in a splicing- and cap-dependent manner to a region near the 5' end of the mRNA where it functions in mRNA export. The recruitment occurs via an interaction between ALYREF/THOC4 and the cap-binding protein NCBP1. DDX39B functions as a bridge between ALYREF/THOC4 and the THO complex. The TREX complex is essential for the export of Kaposi's sarcoma-associated herpesvirus (KSHV) intronless mRNAs and infectious virus production. The recruitment of the TREX complex to the intronless viral mRNA occurs via an interaction between KSHV ORF57 protein and ALYREF/THOC4.
  • Sequence similarities

    Belongs to the THOC7 family.
  • Cellular localization

    Cytoplasm. Nucleus. Interaction with THOC5 is required for nuclear localization.
  • Information by UniProt

Images

  • 15% SDS-PAGE analysis of 3 µg ab202166.

References

ab202166 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab202166.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up