For the best experience on the Abcam website please upgrade to a modern browser such as Google Chrome

We use cookies to make our site as useful as possible.

Our Cookie Policy explains how you can opt-out of the cookies we use.

If you continue without changing your cookie settings, we'll assume you’re happy with this.

Continue Continue

United States
Your country/region is currently set to:

If incorrect, please enter your country/region into the box below, to view site information related to your country/region.

Call (888) 77-ABCAM (22226) or contact us
Need help? Contact us

  • My account
  • Sign out
Sign in or Register with us

Welcome

Sign in or

Don't have an account?

Register with us
My basket
Quick order
Abcam homepage

  • Research Products
    By product type
    Primary antibodies
    Secondary antibodies
    ELISA and Matched Antibody Pair Kits
    Cell and tissue imaging tools
    Cellular and biochemical assays
    Proteins and Peptides
    By product type
    Proteomics tools
    Agonists, activators, antagonists and inhibitors
    Cell lines and Lysates
    Multiplex miRNA assays
    Multiplex Assays
    By research area
    Cancer
    Cardiovascular
    Cell Biology
    Epigenetics
    Metabolism
    Developmental Biology
    By research area
    Immunology
    Microbiology
    Neuroscience
    Signal Transduction
    Stem Cells
  • Diagnostic & Therapeutic Solutions
    Custom solutions & partnerships

    Custom antibody development and commercial partnerships to advance your diagnostic and therapeutic discovery.

    Create custom solutions with us

    Partner with us

  • Support
    Support hub

    Access advice and support for any research roadblock

    View support hub

    Protocols

    Your experiments laid out step by step

    View protocols

  • Events
    • Conference calendar
    • Cancer
    • Cardiovascular
    • Epigenetics & Nuclear signaling
    • Immunology
    • Neuroscience
    • Stem cells
    • Tradeshows
    • Scientific webinars
    Keep up to date with the latest events

    Full event breakdown with abstracts, speakers, registration and more

    View global event calendar

  • Pathways
    Cell signalling pathways

    View all pathways

    View all interactive pathways

  1. Link

    recombinant-human-thrombomodulin-protein-ab98989.pdf

  1. Send me a copy of this email
    I agree to the terms and conditions.
Cardiovascular Blood Coagulation Regulatory
Share by email
Bioactive grade

Recombinant human Thrombomodulin protein (ab98989)

  • Datasheet
  • SDS
Submit a review Q&A (1)

Product price, shipping and contact information

Currently unavailable

Sorry, we can't display this right now.

Please contact us to place your order, or try again later.

 

Loading size & price…

 

Shipping and order information

Abpromise

Guaranteed product quality, expert customer support.

Find out more.

Key features and details

  • Expression system: HEK 293 cells
  • Purity: > 95% SDS-PAGE
  • Endotoxin level: < 0.100 Eu/µg
  • Active: Yes
  • Suitable for: SDS-PAGE, Functional Studies

You may also be interested in

ELISA
Product image
Human Thrombomodulin ELISA Kit (CD141) (ab46508)

View more associated products

Description

  • Product name

    Recombinant human Thrombomodulin protein
    See all Thrombomodulin proteins and peptides
  • Biological activity

    Biological Activity : Measured by its ability to activate protein C induced cleavage of the chromogenic substrate, BOC-Asp-Pro Arg-AMC in the presence of thrombin. The specific activity is greater than 500 pmoles/min/ug.
  • Purity

    > 95 % SDS-PAGE.
    Purity: > 98% by SDS-PAGE gel and HPLC analyses.
  • Endotoxin level

    < 0.100 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

    P07204
  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      APAEPQPGGSQCVEHDCFALYPGPATFLNASQICDGLRGHLMTVRSSVAA DVISLLLNGDGGVGRRRLWIGLQLPPGCGDPKRLGPLRGFQWVTGDNNTS YSRWARLDLNGAPLCGPLCVAVSAAEATVPSEPIWEEQQCEVKADGFLCE FHFPATCRPLAVEPGAAAAAVSITYGTPFAARGADFQALPVGSSAAVAPL GLQLMCTAPPGAVQGHWAREAPGAWDCSVENGGCEHACNAIPGAPRCQCP AGAALQADGRSCTASATQSCNDLCEHFCVPNPDQPGSYSCMCETGYRLAA DQHRCEDVDDCILEPSPCPQRCVNTQGGFECHCYPNYDLVDGECVEPVDP CFRANCEYQCQPLNQTSYLCVCAEGFAPIPHEPHRCQMFCNQTACPADCD PNTQASCECPEGYILDDGFICTDIDECENGGFCSGVCHNLPGTFECICGP DSALARHIGTDCDSGKVDGGDSGSGEPPPSPTPGSTLTPPA
    • Predicted molecular weight

      52 kDa
    • Amino acids

      19 to 509

Associated products

    Specifications

    Our Abpromise guarantee covers the use of ab98989 in the following tested applications.

    The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

    • Applications

      SDS-PAGE

      Functional Studies

    • Form

      Lyophilized
    • Additional notes

      For lot specific reconstitution information please contact our Scientific Support Team.

    • Concentration information loading...

    Preparation and Storage

    • Stability and Storage

      Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Please see notes section.

      Constituent: 0.164% Sodium phosphate

      This product is an active protein and may elicit a biological response in vivo, handle with caution.

    • Reconstitution
      For lot specific reconstitution information please contact our Scientific Support Team.

    General Info

    • Alternative names

      • AHUS 6
      • AHUS6
      • BDCA 3
      • BDCA3
      • CD 141
      • CD141
      • CD141 antigen
      • Fetomodulin
      • Thbd
      • THPH12
      • THRM
      • Thrombomodulin
      • TM
      • TRBM_HUMAN
      see all
    • Function

      Thrombomodulin is a specific endothelial cell receptor that forms a 1:1 stoichiometric complex with thrombin. This complex is responsible for the conversion of protein C to the activated protein C (protein Ca). Once evolved, protein Ca scissions the activated cofactors of the coagulation mechanism, factor Va and factor VIIIa, and thereby reduces the amount of thrombin generated.
    • Tissue specificity

      Endothelial cells are unique in synthesizing thrombomodulin.
    • Involvement in disease

      Defects in THBD are the cause of thrombophilia due to thrombomodulin defect (THR-THBD) [MIM:188040]. A hemostatic disorder characterized by a tendency to thrombosis.
      Defects in THBD are a cause of susceptibility to hemolytic uremic syndrome atypical type 6 (AHUS6) [MIM:612926]. An atypical form of hemolytic uremic syndrome. It is a complex genetic disease characterized by microangiopathic hemolytic anemia, thrombocytopenia, renal failure and absence of episodes of enterocolitis and diarrhea. In contrast to typical hemolytic uremic syndrome, atypical forms have a poorer prognosis, with higher death rates and frequent progression to end-stage renal disease. Note=Susceptibility to the development of atypical hemolytic uremic syndrome can be conferred by mutations in various components of or regulatory factors in the complement cascade system. Other genes may play a role in modifying the phenotype.
    • Sequence similarities

      Contains 1 C-type lectin domain.
      Contains 6 EGF-like domains.
    • Post-translational
      modifications

      N-glycosylated.
      The iron and 2-oxoglutarate dependent 3-hydroxylation of aspartate and asparagine is (R) stereospecific within EGF domains.
    • Cellular localization

      Membrane.
    • Target information above from: UniProt accession P07204 The UniProt Consortium
      The Universal Protein Resource (UniProt) in 2010
      Nucleic Acids Res. 38:D142-D148 (2010) .

      Information by UniProt

    Protocols

    To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.

    Click here to view the general protocols

    Datasheets and documents

    • Datasheet
    • SDS
  • References (0)

    Publishing research using ab98989? Please let us know so that we can cite the reference in this datasheet.

    ab98989 has not yet been referenced specifically in any publications.

    Customer reviews and Q&As

    Show All Reviews Q&A
    Submit a review Submit a question

    Question

    Inquiry: Re:Thrombomodulin protein (Active) (ab98989) HI, I am interested in your product: recombinant Thrombomodulin protein (Active) (ab98989) I was wondering if you could provide me with some information. 1)Are you producing the recombinant Thrombomodulin in-house or do you use an external provider, if so, which one? (I have ordered from a different source before and would like to avoid repetition). 2)Is the recombinant Thrombomodulin expressed with its complete extracellular domain, including the Ser/Thr-rich region 3) Is it fully glycosylated, specifically with chondroiting sulfate? 4) Could you maybe provide me with an amino acid sequence? Many thanks

    Read More

    Abcam community

    Verified customer

    Asked on Jul 04 2012

    Answer

    Thank you for your enquiry and your interest in our products.

    We produce some of our products in-house and others are sourced from suppliers whose products we believe will be of interest to our customers. This product falls into the latter category. The identity of our suppliers remains commercially sensitive information.

    This product is a recombinant fragment, corresponding to amino acids 19-509 (the extracellular domain) of Human Thrombomodulin, expressed in HEK293 cells; 491 amino acids, Predicted MWt 51.5 kDa (UniProt P07204) and has only been tested in SDS-PAGE. The sequence is provided on the on-line product datasheet:

    APAEPQPGGSQCVEHDCFALYPGPATFLNASQICDGLRGH LMTVRSSVAADVISLLLNGDGGVGRRRLWIGLQLPPGCGD PKRLGPLRGFQWVTGDNNTSYSRWARLDLNGAPLCGPLCV AVSAAEATVPSEPIWEEQQCEVKADGFLCEFHFPATCRPL AVEPGAAAAAVSITYGTPFAARGADFQALPVGSSAAVAPL GLQLMCTAPPGAVQGHWAREAPGAWDCSVENGGCEHACNA IPGAPRCQCPAGAALQADGRSCTASATQSCNDLCEHFCVP NPDQPGSYSCMCETGYRLAADQHRCEDVDDCILEPSPCPQ RCVNTQGGFECHCYPNYDLVDGECVEPVDPCFRANCEYQC QPLNQTSYLCVCAEGFAPIPHEPHRCQMFCNQTACPADCD PNTQASCECPEGYILDDGFICTDIDECENGGFCSGVCHNL PGTFECICGPDSALARHIGTDCDSGKVDGGDSGSGEPPPS PTPGSTLTPPA

    If you need any further assistance in the future, please do not hesitate to contact me.

    Read More

    Abcam Scientific Support

    Answered on Jul 04 2012

    Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
    For licensing inquiries, please contact partnerships@abcam.com

    Get resources and offers direct to your inbox Sign up
    A-Z by research area
    • Cancer
    • Cardiovascular
    • Cell biology
    • Developmental biology
    • Epigenetics & Nuclear signaling
    • Immunology
    • Metabolism
    • Microbiology
    • Neuroscience
    • Signal transduction
    • Stem cells
    A-Z by product type
    • Primary antibodies
    • Secondary antibodies
    • Biochemicals
    • Isotype controls
    • Flow cytometry multi-color selector
    • Kits
    • Loading controls
    • Lysates
    • Peptides
    • Proteins
    • Slides
    • Tags and cell markers
    • Tools & Reagents
    Help & support
    • Support
    • Make an Inquiry
    • Protocols & troubleshooting
    • Placing an order
    • RabMAb products
    • Biochemical product FAQs
    • Training
    • Browse by Target
    Company
    • Corporate site
    • Investor relations
    • Company news
    • Careers
    • About us
    • Blog
    Events
    • Tradeshows
    • Conferences
    International websites
    • abcam.cn
    • abcam.co.jp

    Join with us

    • LinkedIn
    • facebook
    • Twitter
    • YouTube
    • Terms of sale
    • Website terms of use
    • Cookie policy
    • Privacy policy
    • Legal
    • Modern slavery statement
    © 1998-2021 Abcam plc. All rights reserved.