Recombinant human Thrombomodulin protein (ab98989)
Key features and details
- Expression system: HEK 293 cells
- Purity: > 95% SDS-PAGE
- Endotoxin level: < 0.100 Eu/µg
- Active: Yes
- Suitable for: SDS-PAGE, Functional Studies
Description
-
Product name
Recombinant human Thrombomodulin protein
See all Thrombomodulin proteins and peptides -
Biological activity
Biological Activity : Measured by its ability to activate protein C induced cleavage of the chromogenic substrate, BOC-Asp-Pro Arg-AMC in the presence of thrombin. The specific activity is greater than 500 pmoles/min/ug. -
Purity
> 95 % SDS-PAGE.
Purity: > 98% by SDS-PAGE gel and HPLC analyses. -
Endotoxin level
< 0.100 Eu/µg -
Expression system
HEK 293 cells -
Accession
-
Protein length
Protein fragment -
Animal free
No -
Nature
Recombinant -
-
Species
Human -
Sequence
APAEPQPGGSQCVEHDCFALYPGPATFLNASQICDGLRGHLMTVRSSVAA DVISLLLNGDGGVGRRRLWIGLQLPPGCGDPKRLGPLRGFQWVTGDNNTS YSRWARLDLNGAPLCGPLCVAVSAAEATVPSEPIWEEQQCEVKADGFLCE FHFPATCRPLAVEPGAAAAAVSITYGTPFAARGADFQALPVGSSAAVAPL GLQLMCTAPPGAVQGHWAREAPGAWDCSVENGGCEHACNAIPGAPRCQCP AGAALQADGRSCTASATQSCNDLCEHFCVPNPDQPGSYSCMCETGYRLAA DQHRCEDVDDCILEPSPCPQRCVNTQGGFECHCYPNYDLVDGECVEPVDP CFRANCEYQCQPLNQTSYLCVCAEGFAPIPHEPHRCQMFCNQTACPADCD PNTQASCECPEGYILDDGFICTDIDECENGGFCSGVCHNLPGTFECICGP DSALARHIGTDCDSGKVDGGDSGSGEPPPSPTPGSTLTPPA -
Predicted molecular weight
52 kDa -
Amino acids
19 to 509
-
Associated products
Specifications
Our Abpromise guarantee covers the use of ab98989 in the following tested applications.
The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.
-
Applications
SDS-PAGE
Functional Studies
-
Form
Lyophilized -
Additional notes
For lot specific reconstitution information please contact our Scientific Support Team.
-
Concentration information loading...
Preparation and Storage
-
Stability and Storage
Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C or -80°C. Avoid freeze / thaw cycle. Please see notes section.
Constituent: 0.164% Sodium phosphate
This product is an active protein and may elicit a biological response in vivo, handle with caution.
-
ReconstitutionFor lot specific reconstitution information please contact our Scientific Support Team.
General Info
-
Alternative names
- AHUS 6
- AHUS6
- BDCA 3
see all -
Function
Thrombomodulin is a specific endothelial cell receptor that forms a 1:1 stoichiometric complex with thrombin. This complex is responsible for the conversion of protein C to the activated protein C (protein Ca). Once evolved, protein Ca scissions the activated cofactors of the coagulation mechanism, factor Va and factor VIIIa, and thereby reduces the amount of thrombin generated. -
Tissue specificity
Endothelial cells are unique in synthesizing thrombomodulin. -
Involvement in disease
Defects in THBD are the cause of thrombophilia due to thrombomodulin defect (THR-THBD) [MIM:188040]. A hemostatic disorder characterized by a tendency to thrombosis.
Defects in THBD are a cause of susceptibility to hemolytic uremic syndrome atypical type 6 (AHUS6) [MIM:612926]. An atypical form of hemolytic uremic syndrome. It is a complex genetic disease characterized by microangiopathic hemolytic anemia, thrombocytopenia, renal failure and absence of episodes of enterocolitis and diarrhea. In contrast to typical hemolytic uremic syndrome, atypical forms have a poorer prognosis, with higher death rates and frequent progression to end-stage renal disease. Note=Susceptibility to the development of atypical hemolytic uremic syndrome can be conferred by mutations in various components of or regulatory factors in the complement cascade system. Other genes may play a role in modifying the phenotype. -
Sequence similarities
Contains 1 C-type lectin domain.
Contains 6 EGF-like domains. -
Post-translational
modificationsN-glycosylated.
The iron and 2-oxoglutarate dependent 3-hydroxylation of aspartate and asparagine is (R) stereospecific within EGF domains. -
Cellular localization
Membrane. - Information by UniProt
Protocols
To our knowledge, customised protocols are not required for this product. Please try the standard protocols listed below and let us know how you get on.
References (0)
ab98989 has not yet been referenced specifically in any publications.