Overview

  • Product name

    Recombinant Human Thromboxane synthase protein
  • Protein length

    Protein fragment

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MELRKLYGPLCGYYLGRRMFIVISEPDMIKQVLVENFSNFTNRMASGLEF KSVADSVLFLRDKRWEEVRGALMSAFSPEKLNEMVPLISQACDLLLAHLK RYAESGDAFDIQRCYCNYTTDVVASVAFGTPVDSWQAPEDPFVKHCKRFF EFCIPRPILVLLLSFPSIMVPLARILPNKNRDELNGFFNKLIRNVIALRD QQAAEERRRDFLQMVLDARHSASPMGVQDFDIVRDVFSSTGCKPNPSRQH QPSPMARPLTVDEIVGQAFIFLIAGYEIITNTLSFATYLLATNPDCQEKL LREVDVFKEKHMAPEFCSLEEGLPYLDMVIAETLRMYPPAFRFTREAAQD CEVLGQRIPAGAVLEMAVGALHHDPEHWPSPETFNPERFTAEARQQHRPF TYLPFGAGPRSCLGVRLGLLEVKLTLLHVLHKFRFQACPETQVPLQLESK SALGPKNGVYIKIVSR
    • Molecular weight

      77 kDa including tags
    • Amino acids

      68 to 533

Associated products

Specifications

Our Abpromise guarantee covers the use of ab132158 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml. This protein is best used within three months from the date of receipt.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • BDPLT14
    • CYP5
    • CYP5A1
    • Cytochrome P450 5A1
    • Cytochrome P450, family 5, subfamily A, polypeptide 1
    • FLJ52771
    • GHOSAL
    • Platelet cytochrome P450 subfamily V
    • Tbxas1
    • THAS
    • THAS_HUMAN
    • Thromboxane A synthase 1
    • Thromboxane A synthase 1 (platelet)
    • Thromboxane A synthase 1 (platelet, cytochrome P450, family 5, subfamily A)
    • Thromboxane A synthase 1 platelet cytochrome P450 subfamily V
    • Thromboxane-A synthase
    • TS
    • TXA synthase
    • TXAS
    • TXS
    see all
  • Tissue specificity

    Platelets, lung, kidney, spleen, macrophages and lung fibroblasts.
  • Involvement in disease

    Defects in TBXAS1 are the cause of Ghosal hematodiaphyseal dysplasia (GHDD) [MIM:231095]. GHDD is a rare autosomal recessive disorder characterized by increased bone density with predominant diaphyseal involvement and aregenerative corticosteroid-sensitive anemia. Aregenerative anemia is characterized by bone marrow failure, so that functional marrow cells are regenerated slowly or not at all.
    Defects in TBXAS1 are the cause of thromboxane synthetase deficiency (TBXAS1 deficiency) [MIM:274180]. It is characterized by hemorrhagic diathesis.
  • Sequence similarities

    Belongs to the cytochrome P450 family.
  • Cellular localization

    Endoplasmic reticulum membrane.
  • Information by UniProt

Images

  • SDS-PAGE analysis of ab132158 on a 12.5% gel stained with Coomassie Blue.

References

ab132158 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab132158.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up