Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Species

      Human
    • Sequence

      MQVLTKRYPKNCLLTVMDRYAAEVHNMEQVVMIPSLLRDVQLSGPGGQAQ AEAPDLYTYFTMLKAICVDVDHGLLPREEWQAKV
    • Amino acids

      1 to 84
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab159698 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 mg/ml.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Lpgp
    • LPGP1
    • MGC21659
    • OTTHUMP00000233866
    • S14
    • S14 protein
    • SPOT 14
    • Spot 14 protein
    • SPOT14
    • SPOT14 homolog
    • Thrsp
    • THRSP_HUMAN
    • Thyroid hormone inducible hepatic protein
    • Thyroid hormone responsive
    • Thyroid hormone responsive (SPOT14 homolog rat)
    • Thyroid hormone responsive protein
    • Thyroid hormone responsive SPOT14
    • Thyroid hormone-inducible hepatic protein
    see all
  • Function

    Plays a role in the regulation of lipogenesis, especially in lactating mammary gland. Important for the biosynthesis of triglycerides with medium-length fatty acid chains. May modulate lipogenesis by interacting with MID1IP1 and preventing its interaction with ACACA (By similarity). May function as transcriptional coactivator. May modulate the transcription factor activity of THRB.
  • Tissue specificity

    Mainly expressed in tissues that synthesize triglycerides.
  • Sequence similarities

    Belongs to the SPOT14 family.
  • Cellular localization

    Nucleus. Cytoplasm.
  • Information by UniProt

Images

  • ab159698 on a 12.5% SDS-PAGE stained with Coomassie Blue.

References

ab159698 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab159698.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up