Description

  • Product name

    Recombinant Human THTPA protein
  • Purity

    > 90 % SDS-PAGE.
    ab98233 was purified using conventional chromatography techniques.
  • Expression system

    Escherichia coli
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MGSSHHHHHHSSGLVPRGSHMAQGLIEVERKFLPGPGTEERLQELGGTLE YRVTFRDTYYDTPELSLMQADHWLRRREDSGWELKCPGAAGVLGPHTEYK ELTAEPTIVAQLCKVLRADGLGAGDVAAVLGPLGLQEVASFVTKRSAWKL VLLGADEEEPQLRVDLDTADFGYAVGEVEALVHEEAEVPTALEKIHRLSS MLGVPAQETAPAKLIVYLQRFRPQDYQRLLEVNSSRERPQETEDPDHCLG
    • Predicted molecular weight

      28 kDa including tags
    • Amino acids

      1 to 230
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab98233 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    Mass Spectrometry

  • Mass spectrometry

    MALDI-TOF
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Store at +4°C short term (1-2 weeks). Upon delivery aliquot. Store at -20°C or -80°C. Avoid freeze / thaw cycle.

    pH: 8.00
    Constituents: 0.0154% DTT, 0.316% Tris HCl, 10% Glycerol

General Info

  • Alternative names

    • FLJ33428
    • FLJ36892
    • MGC2652
    • thiamine triphosphatase
    • THTP
    • ThTPase
    see all
  • Relevance

    Thiamine triphosphatase (THTPA) catalyzes the hydrolysis of thiamine triphosphate (THTP) to thiamine diphosphate (THDP), which is the major cellular form of thiamine (vitamin B1).
  • Cellular localization

    Cytoplasm.

Images

  • 15% SDS-PAGE analysis of 3µg ab98233

References

ab98233 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab98233.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up