Overview

Description

  • Nature

    Recombinant
  • Source

    Wheat germ
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
    • Molecular weight

      31 kDa including tags
    • Amino acids

      1 to 44
    • Tags

      GST tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab112365 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    ELISA

    Western blot

    Other

  • Form

    Liquid
  • Additional notes

    Best to use within three months from the date of receipt of this protein.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Fx
    • Hematopoietic system regulatory peptide
    • Prothymosin beta 4
    • PTMB 4
    • PTMB4
    • Seraspenide
    • T beta 4
    • T beta-4
    • TB4X
    • THYB 4
    • Thyb4
    • Thymosin beta 4
    • Thymosin beta 4 X chromosome
    • Thymosin beta 4 X linked
    • TMSB 4
    • TMSB4
    • Tmsb4x
    • TYB4_HUMAN
    see all
  • Function

    Plays an important role in the organization of the cytoskeleton (By similarity). Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization.
    Seraspenide inhibits the entry of hematopoeitic pluripotent stem cells into the S-phase.
  • Tissue specificity

    Expressed in several hemopoietic cell lines and lymphoid malignant cells. Decreased levels in myeloma cells.
  • Sequence similarities

    Belongs to the thymosin beta family.
  • Cellular localization

    Cytoplasm > cytoskeleton.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE showing ab112365 at approximately 30.84 kDa, stained with Coomassie Blue.

References

ab112365 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab112365.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up