Description

  • Product name

    Recombinant Human Thyroglobulin protein
    See all Thyroglobulin proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Protein fragment
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      FSHFIRSGNPNYPYEFSRKVPTFATPWPDFVPRAGGENYKEFSELLPNRQ GLKKADCSFWSKYISSLKTSADGAKGGQSAESEEEELTAGSGLREDLLSL QEPGSKTYSK
    • Predicted molecular weight

      38 kDa including tags
    • Amino acids

      2659 to 2768

Specifications

Our Abpromise guarantee covers the use of ab152743 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    ELISA

    SDS-PAGE

    Western blot

  • Form

    Liquid
  • Additional notes

    Protein concentration is above or equal to 0.05 µg/µl.
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • AITD 3
    • AITD3
    • hTG
    • TDH3
    • Tg
    • TGN
    • THYG_HUMAN
    • Thyroglobulin
    see all
  • Function

    Precursor of the iodinated thyroid hormones thyroxine (T4) and triiodothyronine (T3).
  • Tissue specificity

    Thyroid gland specific.
  • Involvement in disease

    Defects in TG are the cause of congenital hypothyroidism due to dyshormonogenesis type 3 (CHDH3) [MIM:274700]. A disorder due to thyroid dyshormonogenesis, causing large goiters of elastic and soft consistency in the majority of patients. Although the degree of thyroid dysfunction varies considerably among patients with defective thyroglobulin synthesis, patients usually have a relatively high serum free triiodothyronine (T3) concentration with disproportionately low free tetraiodothyronine (T4) level. The maintenance of relatively high free T3 levels prevents profound tissue hypothyroidism except in brain and pituitary, which are dependent on T4 supply, resulting in neurologic and intellectual defects in some cases.
    Variations in TG are associated with susceptibility to autoimmune thyroid disease type 3 (AITD3) [MIM:608175]. AITDs including Graves disease (GD) and Hashimoto thyroiditis (HT), are among the most common human autoimmune diseases. They are complex diseases, which are caused by an interaction between susceptibility genes and nongenetic factors, such as infection.
  • Sequence similarities

    Belongs to the type-B carboxylesterase/lipase family.
    Contains 11 thyroglobulin type-1 domains.
  • Post-translational
    modifications

    Sulfated tyrosines are desulfated during iodination.
  • Cellular localization

    Secreted.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE analysis of ab152743 stained with Coomassie Blue.

References

ab152743 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152743.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up