Overview

Description

  • Nature

    Recombinant
  • Source

    Escherichia coli
  • Amino Acid Sequence
    • Accession
    • Species

      Human
    • Sequence

      MASMTGGQQMGRGHHHHHHGNLYFQGGEFELTPNSMTENGLTAWDKPKHC PDREHDWKLVGMSEACLHRKSHSERRSTLKNEQSSPHLIQTTWTSSIFHL DHDDVNDQSVSSAQTFQTEEKKCKGYIPSYLDKDELCVVCGDKATGYHYR CITCEGCKGFFRRTIQKNLHPSYSCKYEGKCVIDKVTRNQCQECRFKKCI YVGMATDLVLDDSKRLAKRKLIEENREKRRREELQKSIGHKPEPTDEEWE LIKTVTEAHVATNAQGSHWKQKRKFLPEDIGQAPIVNAPEGGKVDLEAFS HFTKIITPAITRVVDFAKKLPMFCELPCEDQIILLKGCCMEIMSLRAAVR YDPESETLTLNGEMAVTRGQLKNGGLGVVSDAIFDLGMSLSSFNLDDTEV ALLQAVLLMSSDRPGLACVERIEKYQDSFLLAFEHYINYRKHHVTHFWPK LLMKVTDLRMIGACHASRFLHMKVECPTELFPPLFLEVFED
    • Amino acids

      2 to 461
    • Tags

      His tag N-Terminus

Specifications

Our Abpromise guarantee covers the use of ab134854 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Functional Studies

    SDS-PAGE

  • Purity

    > 90 % SDS-PAGE.
    ab134854 was expressed in E. coli as inclusion bodies, refolded and chromatographically purified.
  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. Upon delivery aliquot and store at -20°C. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.05% DTT, 0.32% Tris HCl, 0.02% EDTA, 3.4% DL-Arginine

    Buffer also contains a proprietary formulation of NaCl, KCl and Glycerol.

General Info

  • Alternative names

    • Avian erythroblastic leukemia viral (v erb a) oncogene homolog 2
    • C ERBA 2
    • C ERBA BETA
    • c-erbA-2
    • c-erbA-beta
    • ERBA 2
    • ERBA BETA
    • ERBA2
    • Erythroblastic leukemia viral (v erb a) oncogene homolog 2 avian
    • generalized resistance to thyroid hormone
    • GRTH
    • MGC126109
    • MGC126110
    • NR1A2
    • Nuclear receptor subfamily 1 group A member 2
    • Oncogene ERBA2
    • PRTH
    • THB_HUMAN
    • THR1
    • thrB
    • THRB 1
    • THRB 2
    • THRB1
    • THRB2
    • Thyroid hormone nuclear receptor beta variant 1
    • Thyroid hormone receptor beta
    • Thyroid hormone receptor beta 1
    • Thyroid hormone receptor beta 2
    • Thyroid hormone receptor, beta (erythroblastic leukemia viral (v erb a) oncogene homolog 2, avian)
    see all
  • Function

    High affinity receptor for triiodothyronine.
  • Involvement in disease

    Defects in THRB are the cause of generalized thyroid hormone resistance (GTHR) [MIM:188570, 274300]. GTHR is transmitted as an autosomal dominant trait, but an autosomal recessive form also exists. The disease is characterized by goiter, abnormal mental functions, increased susceptibility to infections, abnormal growth and bone maturation, tachycardia and deafness. Affected individuals may also have attention deficit-hyperactivity disorders (ADHD) and language difficulties. GTHR patients also have high levels of circulating thyroid hormones (T3-T4), with normal or slightly elevated thyroid stimulating hormone (TSH).
    Defects in THRB are the cause of selective pituitary thyroid hormone resistance (PRTH) [MIM:145650]; also known as familial hyperthyroidism due to inappropriate thyrotropin secretion. PRTH is a variant form of thyroid hormone resistance and is characterized by clinical hyperthyroidism, with elevated free thyroid hormones, but inappropriately normal serum TSH. Unlike GRTH, where the syndrome usually segregates with a dominant allele, the mode of inheritance in PRTH has not been established.
  • Sequence similarities

    Belongs to the nuclear hormone receptor family. NR1 subfamily.
    Contains 1 nuclear receptor DNA-binding domain.
  • Domain

    Composed of three domains: a modulating N-terminal domain, a DNA-binding domain and a C-terminal ligand-binding domain.
  • Cellular localization

    Nucleus.
  • Information by UniProt

References

ab134854 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab134854.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up