Description

  • Product name

    Recombinant Human Thyroxine Binding Globulin protein
    See all Thyroxine Binding Globulin proteins and peptides
  • Purity

    > 95 % SDS-PAGE.
    Purity is greater than 95% as determined by SEC-HPLC and reducing SDS-PAGE.
  • Endotoxin level

    < 1.000 Eu/µg
  • Expression system

    HEK 293 cells
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      ASPEGKVTACHSSQPNATLYKMSSINADFAFNLYRRFTVETPDKNIFFSP VSISAALVMLSFGACCSTQTEIVETLGFNLTDTPMVEIQHGFQHLICSLN FPKKELELQIGNALFIGKHLKPLAKFLNDVKTLYETEVFSTDFSNISAAK QEINSHVEMQTKGKVVGLIQDLKPNTIMVLVNYIHFKAQWANPFDPSKTE DSSSFLIDKTTTVQVPMMHQMEQYYHLVDMELNCTVLQMDYSKNALALFV LPKEGQMESVEAAMSSKTLKKWNRLLQKGWVDLFVPKFSISATYDLGATL LKMGIQHAYSENADFSGLTEDNGLKLSNAAHKAVLHIGEKGTEAAAVPEV ELSDQPENTFLHPIIQIDRSFMLLILERSTRSILFLGKVVNPTEAVDHHH HHH
    • Predicted molecular weight

      45 kDa including tags
    • Amino acids

      21 to 415
    • Tags

      His tag C-Terminus

Specifications

Our Abpromise guarantee covers the use of ab152021 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    SDS-PAGE

    HPLC

  • Form

    Lyophilised
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped at 4°C. The lyophilized protein is stable for a few weeks at room temperature. Store at -20°C long term.

    pH: 7.20
    Constituents: 94% Phosphate Buffer, 5% Trehalose, 0.88% Sodium chloride

  • Reconstitution
    Always centrifuge tubes before opening. Do not mix by vortex or pipetting. Dissolve the lyophilized protein in 1X PBS. It is not recommended to reconstitute to a concentration less than 100 µg/ml.
    Reconstituted protein solution can be stored at 4-7°C for 2-7 days. For long term storage aliquot and store at < -20°C.

General Info

  • Alternative names

    • Serine (or cysteine) proteinase inhibitor clade A (alpha 1 antiproteinase antitrypsin) member 7
    • Serpin A7
    • Serpin peptidase inhibitor clade A (alpha 1 antiproteinase antitrypsin) member 7
    • Serpin peptidase inhibitor, clade A, member 7
    • Serpina7
    • T4 binding globulin
    • TBG
    • TBG, serum
    • THBG_HUMAN
    • Thyroxin binding globulin
    • Thyroxine binding globulin
    • Thyroxine-binding globulin
    • Thyroxine-binding globulin od serum
    see all
  • Information by UniProt

References

ab152021 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab152021.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up