Description

  • Product name

    Recombinant Human TIA1 protein
    See all TIA1 proteins and peptides
  • Expression system

    Wheat germ
  • Accession

  • Protein length

    Full length protein
  • Animal free

    No
  • Nature

    Recombinant
    • Species

      Human
    • Sequence

      MEDEMPKTLYVGNLSRDVTEALILQLFSQIGPCKNCKMIMDTAGNDPYCF VEFHEHRHAAAALAAMNGRKIMGKEVKVNWATTPSSQKKDTSSSTVVSTQ RSQDHFHVFVGDLSPEITTEDIKAAFAPFGRISDARVVKDMATGKSKGYG FVSFFNKWDAENAIQQMGGQWLGGRQIRTNWATRKPPAPKSTYECRCIGE EKEMWNFGEKYARF
    • Predicted molecular weight

      49 kDa including tags
    • Amino acids

      1 to 214

Specifications

Our Abpromise guarantee covers the use of ab131879 in the following tested applications.

The application notes include recommended starting dilutions; optimal dilutions/concentrations should be determined by the end user.

  • Applications

    Western blot

    SDS-PAGE

    ELISA

  • Form

    Liquid
  • Concentration information loading...

Preparation and Storage

  • Stability and Storage

    Shipped on dry ice. Upon delivery aliquot and store at -80ºC. Avoid freeze / thaw cycles.

    pH: 8.00
    Constituents: 0.31% Glutathione, 0.79% Tris HCl

General Info

  • Alternative names

    • Cytotoxic granule associated RNA binding protein
    • Cytotoxic granule associated RNA binding protein 1
    • mTIA-1
    • Nucleolysin TIA 1 isoform p40
    • Nucleolysin TIA-1 isoform p40
    • Nucleolysin TIA1 isoform p40
    • p40 TIA 1
    • p40-TIA-1
    • p40-TIA-1 (containing p15-TIA-1)
    • RNA binding protein TIA 1
    • RNA binding protein TIA1
    • RNA-binding protein TIA-1
    • T-cell-restricted intracellular antigen-1
    • Tia
    • TIA 1
    • TIA 1 cytotoxic granule associated RNA binding protein
    • TIA-1
    • TIA1
    • TIA1 cytotoxic granule associated RNA binding protein
    • TIA1 cytotoxic granule associated RNA binding protein like 1
    • TIA1 protein
    • TIA1_HUMAN
    • TIAL1
    • TIAR
    • WDM
    see all
  • Function

    Involved in alternative pre-RNA splicing and regulation of mRNA translation by binding to AU-rich elements (AREs) located in mRNA 3' untranslated regions (3' UTRs). Possesses nucleolytic activity against cytotoxic lymphocyte target cells. May be involved in apoptosis.
  • Sequence similarities

    Contains 3 RRM (RNA recognition motif) domains.
  • Cellular localization

    Cytoplasmic granule. Nucleus. Accumulates in cytoplasmic stress granules (SG) following cellular damage.
  • Information by UniProt

Images

  • 12.5% SDS-PAGE stained with Coomassie Blue showing ab131879 at approximately 49.28 kDa.

References

ab131879 has not yet been referenced specifically in any publications.

Customer reviews and Q&As

There are currently no Customer reviews or Questions for ab131879.
Please use the links above to contact us or submit feedback about this product.

Please note: All products are "FOR RESEARCH USE ONLY. NOT FOR USE IN DIAGNOSTIC PROCEDURES"
For licensing inquiries, please contact partnerships@abcam.com

Sign up